DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and Rgk1

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_725875.3 Gene:Rgk1 / 14462605 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster


Alignment Length:208 Identity:60/208 - (28%)
Similarity:97/208 - (46%) Gaps:29/208 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKKPTAGPALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKK---VVLDGEEVQIDI 63
            :..|..||  ::|:|:|...||||:|..|||..|::..|:.:..|...:|   |:|.|||.::..
  Fly  1113 TSNPGNGP--YRVLMLGGPAVGKSSLVSQFMTSEYLHAYDTSIDDESGEKAVSVLLSGEESELIF 1175

  Fly    64 LDTAGQEDYAAIR-----DNYFRSGEGFLCVFSITDDESFQATQEFREQILRV----KNDESIPF 119
            :|    ..|..:.     .||  ...|:..::|..|..||...    ||:|:|    :|......
  Fly  1176 ID----HGYTEMTPDECLTNY--DPHGYCVIYSAADRSSFSVA----EQVLQVLWTNQNIAQKAV 1230

  Fly   120 LLVGNKCDLNDKRKVPLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATS 184
            :||.||.||...|.|...|.:..|..:...::|||.....|||::...|:.:||.:.....|   
  Fly  1231 ILVSNKADLARSRLVTSEEGKAMATAYDCKFIETSVGINHNVDELLVGLLSQIRLKLENPEK--- 1292

  Fly   185 GRAKDRCKKRRLK 197
              ::|..:||.::
  Fly  1293 --SRDLFRKRSIR 1303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 52/173 (30%)
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 57/198 (29%)
small_GTPase 1121..1286 CDD:197466 53/174 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.