DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and RASL10A

DIOPT Version :10

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_011528124.1 Gene:RASL10A / 10633 HGNCID:16954 Length:223 Species:Homo sapiens


Alignment Length:138 Identity:35/138 - (25%)
Similarity:62/138 - (44%) Gaps:11/138 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 QEDYAAIRDNYFRSGEGFLCVFSITDDESFQATQEFREQI--LRVKNDESIPFLLVGNKCDLNDK 131
            :|::...:|...:..:.|:.|:.|...:||...:..|::|  .|.......|.|:||||.|....
Human    92 EEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETRPAGAPEAPILVVGNKRDRQRL 156

  Fly   132 RKVP-LSECQLRAQQWAVPYVETSAKTRENVDKVFFDLMR--EIRSRKTEDSKATSGRAKDRCKK 193
            |..| .:...|..:.|...|:|.|||...:|.::|.:|:|  .:|:|....:....|..      
Human   157 RFGPRRALAALVRRGWRCGYLECSAKYNWHVLRLFRELLRCALVRARPAHPALRLQGAL------ 215

  Fly   194 RRLKCTLL 201
            ...:|:|:
Human   216 HPARCSLM 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 30/109 (28%)
RASL10AXP_011528124.1 P-loop containing Nucleoside Triphosphate Hydrolases <86..223 CDD:476819 34/136 (25%)

Return to query results.
Submit another query.