DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and rit1

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_031747350.1 Gene:rit1 / 100486360 XenbaseID:XB-GENE-5777077 Length:183 Species:Xenopus tropicalis


Alignment Length:172 Identity:72/172 - (41%)
Similarity:109/172 - (63%) Gaps:1/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFS 91
            :|:||:...|.||::||..|:|:.::.:|.|...:||||||||.::.|:||.|.|:||||:..:|
 Frog     1 MTMQFISHRFPEDHDPTIEDAYKMRIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIICYS 65

  Fly    92 ITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPLSECQLRAQQWAVPYVETSAK 156
            |||..||...::|::.|.||:..:..|.:|||||.||:..|:|...|....|:::..|:.||||.
 Frog    66 ITDRRSFHEARDFKQLIYRVRRTDDTPVVLVGNKSDLSRLRQVSKEEGSSLAREFNCPFFETSAA 130

  Fly   157 TRENVDKVFFDLMREIRSRKTEDSKATSGRAKDRCKK-RRLK 197
            .|..:|.||..|:||||.::.|.:.|...:.|.|... :|||
 Frog   131 FRYYIDDVFHALVREIRRKEREAALANERKLKPRATLWKRLK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 64/146 (44%)
rit1XP_031747350.1 P-loop_NTPase 1..155 CDD:422963 66/153 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.