DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and ralb

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001096315.1 Gene:ralb / 100124895 XenbaseID:XB-GENE-494548 Length:206 Species:Xenopus tropicalis


Alignment Length:193 Identity:146/193 - (75%)
Similarity:165/193 - (85%) Gaps:2/193 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAI 75
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog    14 LHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAI 78

  Fly    76 RDNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDE-SIPFLLVGNKCDLNDKRKVPLSEC 139
            ||||||||||||.|||||:.|||.||.||||||||||.:| .||.||||||.||.::|:||:.|.
 Frog    79 RDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLLVGNKSDLEERRQVPMDEA 143

  Fly   140 QLRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATSGRAKDRCKKR-RLKCTLL 201
            :.:|::|.|.|||||||||.||||||||||||:||:|..::|..:|:...:.||. :.:|.||
 Frog   144 RGKAEEWGVQYVETSAKTRANVDKVFFDLMREVRSKKMSENKDKNGKKSGKSKKGFKQRCCLL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 135/162 (83%)
ralbNP_001096315.1 RalA_RalB 15..178 CDD:206710 135/162 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 302 1.000 Inparanoid score I2626
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002545
OrthoInspector 1 1.000 - - otm48220
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1669
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.