DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rala and rap2ab

DIOPT Version :9

Sequence 1:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001139177.1 Gene:rap2ab / 100003903 ZFINID:ZDB-GENE-090312-116 Length:183 Species:Danio rerio


Alignment Length:161 Identity:76/161 - (47%)
Similarity:122/161 - (75%) Gaps:0/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIR 76
            :||:::|||||||||||:||:...|:|.|:||..|.|||::.:|.....::||||||.|.:|::|
Zfish     4 YKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMR 68

  Fly    77 DNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPLSECQL 141
            |.|.::|:||:.|:|:.:.:|||..:..|:||:|||..|.:|.:|||||.||:::|:|..||.|.
Zfish    69 DLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPVILVGNKVDLDNEREVSSSEGQA 133

  Fly   142 RAQQWAVPYVETSAKTRENVDKVFFDLMREI 172
            .|::|..|::|||||::..||::|.:::|::
Zfish   134 LAEEWGCPFMETSAKSKTMVDELFSEIVRQM 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 76/161 (47%)
rap2abNP_001139177.1 Rap2 16..165 CDD:133376 68/149 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.