DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and AT1G22490

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_001320744.1 Gene:AT1G22490 / 838855 AraportID:AT1G22490 Length:326 Species:Arabidopsis thaliana


Alignment Length:175 Identity:41/175 - (23%)
Similarity:67/175 - (38%) Gaps:32/175 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 PAAGSQL-------SAHHHTGHGGRRRTTSSNSNG---AGTREVHNKLEKERRAQLKECYDLLKK 480
            |:.|.:|       .:|....|..:||.|.:..|.   ...|..|..:|:.||.|:.|...:|:.
plant    73 PSLGEELGLTAIDVESHPPPQHRRKRRRTRNCKNKEEIENQRMTHIAVERNRRKQMNEYLAVLRS 137

  Fly   481 VLP-----MGDEDRKKTSNLTILDTAHKYVNSLSHEVCEQEAKIEKLAKQKIELQKRLKQLSLRR 540
            ::|     .||:       .:|:..|..||..|.|.:...|.|     :.:....|..|..:...
plant   138 LMPSSYAQRGDQ-------ASIVGGAINYVKELEHILQSMEPK-----RTRTHDPKGDKTSTSSL 190

  Fly   541 ESPPTDQQIIPQ-ADKAVCLATTATTAPP----TAASGHNGTTIL 580
            ..|.||....|| :.|:......::::|.    |.|..|....|:
plant   191 VGPFTDFFSFPQYSTKSSSDVPESSSSPAEIEVTVAESHANIKIM 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 17/59 (29%)
AT1G22490NP_001320744.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11969
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.