DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and bHLH071

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_568666.1 Gene:bHLH071 / 834712 AraportID:AT5G46690 Length:327 Species:Arabidopsis thaliana


Alignment Length:202 Identity:40/202 - (19%)
Similarity:63/202 - (31%) Gaps:64/202 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 IASSAPAAGSQLSAHHHTGHGGRR-----RTTSSNSNGAGTREVHNKLEKERRAQLKECYDLLKK 480
            |::..|....|..|   |..|.:|     |...:.......|..|..:|:.||.|:.:...:|:.
plant    49 ISNQEPPPQRQPPA---TNRGKKRRRRKPRVCKNEEEAENQRMTHIAVERNRRRQMNQHLSVLRS 110

  Fly   481 VLPM-----GDEDRKKTSNLTILDTAHKYVNSLSHEVCEQEAKIEKLAKQKIELQKRLKQLSLRR 540
            ::|.     ||:       .:|:..|..::..|.|::...||:....||....:.....|.|...
plant   111 LMPQPFAHKGDQ-------ASIVGGAIDFIKELEHKLLSLEAQKHHNAKLNQSVTSSTSQDSNGE 168

  Fly   541 ESPP--------------------------TDQQIIPQADKAVCL------------------AT 561
            :..|                          |.....|..|..|.|                  :|
plant   169 QENPHQPSSLSLSQFFLHSYDPSQENRNGSTSSVKTPMEDLEVTLIETHANIRILSRRRGFRWST 233

  Fly   562 TATTAPP 568
            .|||.||
plant   234 LATTKPP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 14/59 (24%)
bHLH071NP_568666.1 HLH 86..137 CDD:278439 12/57 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11969
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.