DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and AT3G61950

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_567121.1 Gene:AT3G61950 / 825368 AraportID:AT3G61950 Length:358 Species:Arabidopsis thaliana


Alignment Length:257 Identity:55/257 - (21%)
Similarity:89/257 - (34%) Gaps:81/257 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 QRQQQS-------LQQLRSLRPAEISLTPPPAATRKVDISNSRTRSYSLSNVSAARDQQDHPQHQ 369
            :::::|       ||.|:|..|:.......|.....:.:...: ..:.|....:..|.|.|...|
plant    37 EKEEESLQDTVPFLQMLQSEDPSSFFSIKEPNFLTLLSLQTLK-EPWELERYLSLEDSQFHSPVQ 100

  Fly   370 QHANHMQIQQHYGYMRSNIGGVIYGLHKDSADSAASSACGAGAGAAAVGMSIASSAPAAGSQLSA 434
            ...|...                     :.|:.|.||   .....:...|::.||   ..|.|||
plant   101 SETNRFM---------------------EGANQAVSS---QEIPFSQANMTLPSS---TSSPLSA 138

  Fly   435 H-------HH------TGHGGRRRTTSSNSNGAGTREVHNK------LEKERRAQLKECYDLLKK 480
            |       :|      |....:||.|..:.|   ..|:.|:      :|:.||.|:.|..:.|:.
plant   139 HSRRKRKINHLLPQEMTREKRKRRKTKPSKN---NEEIENQRINHIAVERNRRRQMNEHINSLRA 200

  Fly   481 VLP-----MGDEDRKKTSNLTILDTAHKYVNSLSHEVCEQEAKIEKLAKQKIELQKRLKQLS 537
            :||     .||:       .:|:..|..||..|...:            |.:|.|||.:|.|
plant   201 LLPPSYIQRGDQ-------ASIVGGAINYVKVLEQII------------QSLESQKRTQQQS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 17/65 (26%)
AT3G61950NP_567121.1 bHLH_AtFAMA_like 178..251 CDD:381454 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11969
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.