DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and mxd1

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_001072228.1 Gene:mxd1 / 779675 XenbaseID:XB-GENE-943715 Length:221 Species:Xenopus tropicalis


Alignment Length:102 Identity:32/102 - (31%)
Similarity:64/102 - (62%) Gaps:7/102 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 GGRRRTTSSNSNGAGTREVHNKLEKERRAQLKECYDLLKKVLPMGDEDRKKTSNLTILDTAHKYV 505
            |.:|::.|..|  :.:|..||::||.|||.|:.|.:.||.::|:|.|..:.|: |::|..|..::
 Frog    43 GLKRKSKSKKS--SNSRSTHNEMEKNRRAHLRLCLEKLKILVPLGPESNRHTT-LSLLTRAKSHI 104

  Fly   506 NSLSHEVCEQEA--KIEKLAKQKIELQKRLKQLSLRR 540
            ..|  |.|::.:  :||:|.:::..|:::|::..:.|
 Frog   105 KKL--EDCDKRSLHQIEQLQREQRHLKRQLEKFGVER 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 20/54 (37%)
mxd1NP_001072228.1 Nuclear localization signal. /evidence=ECO:0000255 21..49 2/5 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..67 9/25 (36%)
bHLHzip_Mad1 59..135 CDD:381501 26/78 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..202
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.