DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and osgepl1

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:XP_031748583.1 Gene:osgepl1 / 779499 XenbaseID:XB-GENE-948324 Length:435 Species:Xenopus tropicalis


Alignment Length:168 Identity:36/168 - (21%)
Similarity:51/168 - (30%) Gaps:58/168 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 DEDRK-KTSNLTILDTAH-----KYVNSLSH-EVCEQEAKIEKLAKQKIELQKRLKQLSLRRESP 543
            ||.|. |:|.:|.:.|..     ||:::||. .|......:..|.|.                  
 Frog    10 DELRNLKSSCVTKIKTLQWKTMAKYISNLSRIAVVRGRVSVSTLVKY------------------ 56

  Fly   544 PTDQQIIPQADKAVCLATTATTAPPTAASGHNGTTILFDAGNACATGQLTTVINKTNGGATAAAS 608
                      .:.|....|:......|....|| |||.:|.:......|     ||.|.....|.
 Frog    57 ----------PRIVLGIETSCDDTGAAVVDENG-TILGEALHCQKDIHL-----KTGGIIPTVAQ 105

  Fly   609 SKHNGN---------HTGGAT--------TTLTPAMGI 629
            ..|..|         |..|.:        ||:.|.:|:
 Frog   106 HLHRDNITKVVNKAIHASGISPYELSAIATTVKPGLGL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 11/32 (34%)
osgepl1XP_031748583.1 T6A_TsaD_YgjD 60..393 CDD:274748 22/90 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.