DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and mespba

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_571627.1 Gene:mespba / 58070 ZFINID:ZDB-GENE-000406-9 Length:236 Species:Danio rerio


Alignment Length:217 Identity:48/217 - (22%)
Similarity:75/217 - (34%) Gaps:62/217 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 SIASSAPAAGSQ-LSAHHHTGHGGRRRTTSSN----------SNGAGTREVHNKLEKERRAQLKE 473
            ||:|....:..| .|..|.|.....:...|||          .|.:..|:..::.||.|...|.:
Zfish    20 SISSPETTSPDQSFSPPHQTKPPCSKLVKSSNIMRKKRRLRLKNPSERRQNASEKEKLRMRDLTK 84

  Fly   474 CYDLLK-----KVLPMGDEDRK-KTSNLTILDTAHKYVNSLSHEVCEQEAKIEKLAKQKIELQKR 532
            ....|:     .|.|:|....| :|..|||     :|::.||.::...|                
Zfish    85 ALHHLRSFLPASVAPVGQTLTKIETLRLTI-----QYISFLSSQLGLSE---------------- 128

  Fly   533 LKQLSLRRESPPTDQQIIPQADKAVCLATTATTAPPTAASGHNGTTILFDAGNACATGQLTTV-- 595
             ::||.||           |.:.:.|..::      ...|..||..:..:.|.|...||....  
Zfish   129 -EELSYRR-----------QENSSGCSLSS------FECSSVNGGFVGTEQGYALCDGQYEDCSG 175

  Fly   596 ----INKTNGGATAAASSKHNG 613
                ..:..||.|...|::.||
Zfish   176 YGGQYRERYGGLTQQHSTEQNG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 17/60 (28%)
mespbaNP_571627.1 HLH 67..120 CDD:278439 15/57 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.