DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and olig3

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_001103863.1 Gene:olig3 / 566728 ZFINID:ZDB-GENE-080903-1 Length:255 Species:Danio rerio


Alignment Length:286 Identity:65/286 - (22%)
Similarity:96/286 - (33%) Gaps:100/286 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 SIASSAPAAGSQLSAHHHTGH--GGRRRTTSSNSNGAGTREVHNKLEKERRAQLKECYDLLKKVL 482
            |..||:|........|||..|  .|...:.||..|                       :||:|  
Zfish     7 SSRSSSPDMDGMYHHHHHHHHHQDGLLNSVSSTQN-----------------------ELLQK-- 46

  Fly   483 PMGDEDRKKTSNLTILDTAHKYVNSLSHEVCEQEAKIEKLAKQKI--ELQKRLKQLSLRRESPPT 545
             |..|...||      .:..||  .|..:|.|||  |::| :.||  ..:||:..|:|..:..  
Zfish    47 -MASEHLSKT------PSGSKY--KLKKQVTEQE--IQQL-RLKINGRERKRMHDLNLAMDGL-- 97

  Fly   546 DQQIIPQADKAVCLATTATTAPPTAASGHNGTTILFDAGN-----ACATGQLTTVINKTNGGATA 605
             ::::|.|.           .|.........|.:|  |.|     ..:..::..::.:..||..:
Zfish    98 -REVMPYAH-----------GPSVRKLSKIATLLL--ARNYILMLTSSLDEMKRLVGEIYGGHHS 148

  Fly   606 A---ASSKHNGNHTGGATTTLTPAMGIMTIKNGNGSNGNMLAISPTGGHNHQLHQHHNGSP-AGS 666
            |   .:..|.|.|:.||.                                ||:|....||. :||
Zfish   149 AFHCGTVSHGGAHSAGAA--------------------------------HQVHHPLLGSALSGS 181

  Fly   667 PSGIGATTGATITRGSPT--PSTPSP 690
            .|...:..|.|..|...|  .|||:|
Zfish   182 TSSTLSLPGLTSIRAPHTLMKSTPTP 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 10/54 (19%)
olig3NP_001103863.1 HLH 76..129 CDD:278439 13/68 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.