DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and mxd4

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:XP_687970.6 Gene:mxd4 / 559531 ZFINID:ZDB-GENE-050208-44 Length:207 Species:Danio rerio


Alignment Length:233 Identity:53/233 - (22%)
Similarity:92/233 - (39%) Gaps:83/233 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 RRRTTSSNSNGA-GTREVHNKLEKERRAQLKECYDLLKKVLPMGDEDRKKTSNLTILDTAHKYVN 506
            |::|.|..|... ..|..||:|||.|||:|:...:.||:::|:|.:..:.|: |::|..|..::.
Zfish    39 RKKTKSPISRKPHNNRSSHNELEKHRRAKLRLYLEQLKQLVPLGPDSTRHTT-LSLLKRAKMHIK 102

  Fly   507 SLSHEVCEQEAKI----EKLAKQKIELQKRLKQLSLR-RESPPTDQQIIPQADKAVCLATTATTA 566
            .|.    ||:.|.    |:|.::...|::||:|||:: .|...||..                  
Zfish   103 KLE----EQDRKALNMKEQLQREHRYLKRRLEQLSVQGLERIRTDSM------------------ 145

  Fly   567 PPTAASGHNGTTILFDA---------GNACATGQLTTVINKTNG--GATAAASSKHNGNHTGGAT 620
                     |:||..|:         |.....|:..:|.:.::|  ..:..:||...|:|:    
Zfish   146 ---------GSTISTDSEQEVDVDIEGMEFMPGEGDSVDSISDGEDHYSLQSSSSDGGHHS---- 197

  Fly   621 TTLTPAMGIMTIKNGNGSNGNMLAISPTGGHNHQLHQH 658
                                          |:|:|..|
Zfish   198 ------------------------------HSHRLQAH 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 19/54 (35%)
mxd4XP_687970.6 HLH 58..110 CDD:197674 19/56 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.