DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and mntb

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:XP_005170328.1 Gene:mntb / 556663 ZFINID:ZDB-GENE-070820-8 Length:572 Species:Danio rerio


Alignment Length:402 Identity:104/402 - (25%)
Similarity:155/402 - (38%) Gaps:132/402 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 PSVTTSP-PASTDFMLLAAAATSATSATPATATSAAA-TAASNPAKRKLSSIAEIPSKFLVVSDA 275
            |.|...| |.:....::.....:|:.|.|....:||. ||.:.|....|:|         .:|.:
Zfish    73 PPVPPPPLPPAVPITVIPIPVVTASPAVPQIQPAAALHTAPTLPVVSPLTS---------ALSQS 128

  Fly   276 KGVYSAHTHPNGFA-----ADSLGVDNNETMIKKLMQNLQSQRQQQSLQQL-RSLRPAEISLTPP 334
            |.:.|...|.:..|     .:|:.:.||..         |:.:.|..||.. .|:..|:..|.|.
Zfish   129 KDMLSPQQHRHLIAHVKAETNSVALPNNSP---------QAAQTQSLLQPFPASIITAQQHLLPQ 184

  Fly   335 PAATRKVDISNSRTRSYSLSNVSAARDQQDHPQHQQHANHMQIQQHYGYMRSNIGGVIY--GLHK 397
            ||.|:              :..:.|:.|..........|...::.     ..|:.|...  |.|.
Zfish   185 PALTQ--------------TQPTPAQGQPGQLGQPARPNGATVED-----PRNLDGKRRPGGYHS 230

  Fly   398 DSADSAASSACGAGAGAAAVGMSIASSAPAAGSQLSAHHHTGHGGRRRTTSSNSNGAGTREVHNK 462
            ||.||..:..|                      :|..|.                 |||||||||
Zfish   231 DSGDSWTTFYC----------------------ELPTHI-----------------AGTREVHNK 256

  Fly   463 LEKERRAQLKECYDLLKKVLPMGDEDRKKTSNLTILDTAHKYVNSLSHEVCEQEAKIEKLAKQKI 527
            |||.|||.||||::.||:.:|..||  ||||||::|.:|.:|:.:|..:..|.|.::|:||::||
Zfish   257 LEKNRRAHLKECFETLKRNVPNVDE--KKTSNLSVLRSALRYIQTLKRKEKEYEHEMERLAREKI 319

  Fly   528 ELQKRLKQLS---------------LRRESPPTDQQIIPQADKAVCLATTATTA----------- 566
            ..|:||.:|.               ||:...|.|.|           |:|:|.:           
Zfish   320 ATQQRLAELKNELSQCIDIIEINRILRQTVQPEDDQ-----------ASTSTASEGEDNFSQDPE 373

  Fly   567 -------PPTAA 571
                   ||:||
Zfish   374 DDMLSSPPPSAA 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 31/54 (57%)
mntbXP_005170328.1 HLH 251..301 CDD:278439 30/51 (59%)
bZIP 292..333 CDD:269834 14/40 (35%)
coiled coil 292..333 CDD:269834 14/40 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I10165
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006432
OrthoInspector 1 1.000 - - otm25975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11969
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3297
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.