DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and mxi1

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:XP_031760881.1 Gene:mxi1 / 493491 XenbaseID:XB-GENE-493086 Length:243 Species:Xenopus tropicalis


Alignment Length:126 Identity:36/126 - (28%)
Similarity:67/126 - (53%) Gaps:11/126 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 RRRTTSSNSNGAG-TREVHNKLEKERRAQLKECYDLLKKVLPMGDEDRKKTSNLTILDTAHKYVN 506
            :||..|...:|.| :|..||:|||.|||.|:.|.:.||.::|: :.|..:.:.|.:|:.|..::.
 Frog    67 QRRIKSKRCSGLGISRSTHNELEKNRRAHLRLCLERLKDLIPL-ESDAARHTTLGLLNKAKLHIK 130

  Fly   507 SLSHEVCEQEAKIEKLAKQKIELQKRLKQLSLRRESPPTDQQIIPQADKAVCLATTATTAP 567
            .|.......:.::|.|.:::..|::||:||....|         |:..::..:.:.|:|.|
 Frog   131 KLEDTSRRGQHQLEVLEREQRFLKRRLEQLQGGTE---------PERVRSDSIGSHASTDP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 19/54 (35%)
mxi1XP_031760881.1 bHLHzip_MXI1 81..160 CDD:381500 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.