DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and net

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster


Alignment Length:339 Identity:64/339 - (18%)
Similarity:101/339 - (29%) Gaps:118/339 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 PTSTPSVTTSPPA-------STDFMLLAAAATSATSATPATATSAAATAASNPAKRKLSSIAEIP 266
            |..|.|..:.|.|       |::...:....|..:.:.|...:||:.. |:.|.|:::...:...
  Fly    63 PKGTDSADSKPIALVRNKRKSSEPFKVVGLTTPNSKSMPGPPSSASMN-ATGPLKKRIRYTSSAD 126

  Fly   267 SKFLVVSDAKGVYSAHTHPNGFAADSLGVDNNETMIKKLMQNLQSQRQQQSLQQLRSLRPAEISL 331
            |..::...|    .....||.....:|.:.:      ::|.|                 ||.|.:
  Fly   127 SAVVLTPPA----IDSPPPNSCIPSTLRLQH------EIMPN-----------------PAHIYV 164

  Fly   332 TPPPAATRKVDISNSRTRSYSLSNVSAARDQQDHPQHQQHANHMQIQQHYGYMRSNIGGVIYGLH 396
            ..|...|              |....||..:|..|.                       .:....
  Fly   165 RHPGVTT--------------LHRSLAAHPEQLEPL-----------------------ALVTTK 192

  Fly   397 KDSADSAASSACGAGAGAAAVGMSI-ASSAPAAGSQLSAHHHTGHGGRRRTTSS----------- 449
            |...|.|              |..| |.||...|.|.||........::.:|||           
  Fly   193 KQCVDQA--------------GPKIEAFSALLIGKQPSAKKTLKERTQKESTSSSFLEASLSDED 243

  Fly   450 -NSNGAG---------------TREVH---NKLEKERRAQLKECYDLLKKVLPMGDEDRKKTSNL 495
             |..|..               |||..   |..|:.|...:...|:.|::.:| .....:|.|.|
  Fly   244 LNKTGLAPISRPHQHQRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVP-AYASTQKLSKL 307

  Fly   496 TILDTAHKYVNSLS 509
            ::|..|..|:.:||
  Fly   308 SVLRVACSYILTLS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 16/56 (29%)
netNP_001259789.1 HLH 269..320 CDD:278439 12/51 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.