DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and ARNTL

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:XP_016873227.1 Gene:ARNTL / 406 HGNCID:701 Length:674 Species:Homo sapiens


Alignment Length:189 Identity:40/189 - (21%)
Similarity:66/189 - (34%) Gaps:46/189 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 DHPQHQQHANHMQIQQHYGYMRSNIGGVIYGLHKDSADSAASSACGAGAGAAAVGMSIASSAPAA 428
            |||...|              |.:|...|    .|......:....:..|.:.|..:......:.
Human    41 DHPMADQ--------------RMDISSTI----SDFMSPGPTDLLSSSLGTSGVDCNRKRKGSST 87

  Fly   429 GSQLSAH----------HHTGHGGRRRTTSSNSNGAGTREVHNKLEKERRAQLKECYDLLKKVLP 483
            ..|.|..          .:|.|.||.:         ..||.|:::||.||.::....|.|..::|
Human    88 DYQESMDTDKDDPHGRLEYTEHQGRIK---------NAREAHSQIEKRRRDKMNSFIDELASLVP 143

  Fly   484 MGDEDRKKTSNLTILDTAHKYVNSL---SHEVCEQEAKIEKLAKQKIELQKRLKQLSLR 539
            ..:...:|...||:|..|.:::.:|   ::...|...|...|:..:      ||.|.||
Human   144 TCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDE------LKHLILR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 16/57 (28%)
ARNTLXP_016873227.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.