DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and Max

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_001246833.1 Gene:Max / 40095 FlyBaseID:FBgn0017578 Length:161 Species:Drosophila melanogaster


Alignment Length:112 Identity:33/112 - (29%)
Similarity:56/112 - (50%) Gaps:10/112 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 TGHGGRRRTTSSNSNGAGTREVHNKLEKERRAQLKECYDLLKKVLP--MGDEDRKKTSNLTILDT 500
            ||.|..|.|.::|...|..|..||.||:.||..:||.:..|::.:|  .|:    |.|...||..
  Fly    22 TGLGSSRHTNTANFTQAEKRAHHNALERRRRDHIKESFTNLREAVPTLKGE----KASRAQILKK 82

  Fly   501 AHKYVNSLSHEVCEQEAKIEKLAKQKIELQKRLKQLSLRRESPPTDQ 547
            ..:.:.::..::.|.:..||::.:|...:.|:::.|    ||...||
  Fly    83 TTECIQTMRRKISENQKDIEEIKRQNNIIAKQIQAL----ESSNGDQ 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 16/56 (29%)
MaxNP_001246833.1 HLH 40..91 CDD:278439 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.