DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and mxd3

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_957350.1 Gene:mxd3 / 394031 ZFINID:ZDB-GENE-040426-1588 Length:200 Species:Danio rerio


Alignment Length:96 Identity:31/96 - (32%)
Similarity:61/96 - (63%) Gaps:5/96 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 RRRTTSSNSNGAGTREVHNKLEKERRAQLKECYDLLKKVLPMGDEDRKKTSNLTILDTAHKYVNS 507
            :::.:.|:|:...:|.|||:|||.|||||:.|.:.||:.:|:..:..:.|: |.:|..|..::..
Zfish    45 KKQKSKSHSSPGNSRSVHNELEKHRRAQLRHCLEQLKQQVPLSSDSSRNTT-LNLLRQAQLHIKK 108

  Fly   508 LSHEVCEQEAKI--EKLAKQKIELQKRLKQL 536
            |..:  ::.||:  ::|..::.||:.||::|
Zfish   109 LQEQ--DERAKLLKDRLRWEQRELRTRLEKL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 21/54 (39%)
mxd3NP_957350.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..69 9/23 (39%)
HLH 63..112 CDD:197674 18/49 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..165 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3297
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.