DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and Mxd1

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_001094219.1 Gene:Mxd1 / 362391 RGDID:1564525 Length:232 Species:Rattus norvegicus


Alignment Length:142 Identity:42/142 - (29%)
Similarity:71/142 - (50%) Gaps:18/142 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 AAAVGMSIASSAPAAGSQLSAHHHTGHG-------------GRRRTTSSNSNGAGTREVHNKLEK 465
            |.||||:|.....||...........||             ..:|......|...:|..||::||
  Rat     2 ATAVGMNIQLLLEAADYLERREREAEHGYASMLPYSSKDRDAFKRRNKPKKNSTSSRSTHNEMEK 66

  Fly   466 ERRAQLKECYDLLKKVLPMGDEDRKKTSNLTILDTAHKYVNSLSHEVCEQEA--KIEKLAKQKIE 528
            .|||.|:.|.:.||.::|:|.|..:.|: |::|..|..::..|  |.|:::|  :|::|.:::..
  Rat    67 NRRAHLRLCLEKLKGLVPLGPESSRHTT-LSLLTKAKLHIKKL--EDCDRKAVHQIDQLQREQRH 128

  Fly   529 LQKRLKQLSLRR 540
            |::||::|...|
  Rat   129 LKRRLEKLGAER 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 20/54 (37%)
Mxd1NP_001094219.1 HLH 54..110 CDD:238036 20/58 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.