DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and Tal1

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_001101428.2 Gene:Tal1 / 313507 RGDID:1306748 Length:329 Species:Rattus norvegicus


Alignment Length:303 Identity:64/303 - (21%)
Similarity:100/303 - (33%) Gaps:77/303 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 AAGRTTTTRITTTPAILTKLMGNSVTPASNTTSLPTSTPSVTTSPPASTDFMLLAAAATSATSAT 239
            |..|..||.:...|.     ...:..|||....||.....|..||||      |||         
  Rat    84 ARHRVPTTELCRPPG-----PAPAPAPASAPAELPGDGRMVQLSPPA------LAA--------- 128

  Fly   240 PATATSAAATAASNPAKRKLSSIAEIPSKFLVVSDAKGVYSAHT----HPNGFAADSLGVDNNET 300
            ||....|...:.|.|       :|.:.|.|....||..:::.:.    .|:.:..:.  .|...|
  Rat   129 PAGPGRALLYSLSQP-------LASLGSGFFGEPDAFPMFTNNNRVKRRPSPYEMEI--TDGPHT 184

  Fly   301 -MIKKLMQNLQSQRQQQSLQ----QLRSLRPAEISLTPPPAATRKVDISNSRTRSYSLSNVSAAR 360
             :::::..|.:.:.:||::.    :||.|.|..    ||.....|.:|.....:..:..      
  Rat   185 KVVRRIFTNSRERWRQQNVNGAFAELRKLIPTH----PPDKKLSKNEILRLAMKYINFL------ 239

  Fly   361 DQQDHPQHQQHANHMQIQQHYGYMRSNIGGVIYGLHKDSADSAASSACGAGAGAAAVGMSIASSA 425
                       |..:..|:..|..|:..|       ||....|.....|.|.....:...:.|..
  Rat   240 -----------AKLLNDQEEEGTQRAKPG-------KDPMVGAGGGGAGGGIPPEDLLQDVLSPN 286

  Fly   426 PAAGSQL----SAHHHTGHGGRRRTTSS-------NSNGAGTR 457
            .:.||.|    |...:|.....:.|..|       .::|||.|
  Rat   287 SSCGSSLDGAASPDSYTEEPTPKHTPRSLHPALLPAADGAGPR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 1/1 (100%)
Tal1NP_001101428.2 bHLH_TS_TAL1 185..249 CDD:381549 13/84 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.