DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and twist3

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_571060.2 Gene:twist3 / 30176 ZFINID:ZDB-GENE-000210-7 Length:199 Species:Danio rerio


Alignment Length:217 Identity:45/217 - (20%)
Similarity:82/217 - (37%) Gaps:55/217 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 LQQLRSLRPAEIS-LTPPPAATRKVDISNSRTRSYSLSNVSAARDQQDHPQHQQHANHMQIQQHY 381
            :::.:..||.:.: :..|||..||      |........||    |.|.|.....:|....:.  
Zfish    18 IEEEQERRPNKCAVVVSPPAGARK------RLTGPKKEPVS----QDDKPSLDNPSNLAPKRP-- 70

  Fly   382 GYMRSNIGGVIYGLHKDSADSAASSACGAGAGAAAVGMSIASSAPAAGSQLSAHHHTGHGGRRRT 446
                           |.|:.|::||:      ::::...::|.:|..|......|          
Zfish    71 ---------------KRSSPSSSSSS------SSSLVPVVSSVSPVPGQPFEDLH---------- 104

  Fly   447 TSSNSNGAGTREVHNKLEKERRAQLKECYDLLKKVLPMGDEDRKKTSNLTILDTAHKYVNSLSHE 511
                    ..|.:.|..|::|...|.:.:..|:|::|....|  |.|.:.||..|.:|::.| ::
Zfish   105 --------TQRVIANVRERQRTQSLNDAFASLRKIIPTLPSD--KLSKIQILKLASRYIDFL-YQ 158

  Fly   512 VCEQEAKIEKLAKQKIELQKRL 533
            |.:.:....|||.......:||
Zfish   159 VLQSDEMDAKLASCNYLAHERL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 16/54 (30%)
twist3NP_571060.2 HLH 106..156 CDD:278439 15/51 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.