DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and Fer1

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:364 Identity:63/364 - (17%)
Similarity:104/364 - (28%) Gaps:149/364 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 DSADSAASSACGAGAGAAAVGMSIASSAPAAGSQLSAH-------HHTGHGGRRRTTSSN----- 450
            |:.|..|:.|.....|:.|...|.:||....|.:.|:.       :.:|....:..|...     
  Fly     5 DNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAYSSGFNSDQENTEKTFCPFS 69

  Fly   451 ------------SNGAGTREVHNKLEKERRAQLKECYDLLKKVLPMGDEDRKKTSNLTILDTAHK 503
                        |..|..|:..|..|:.|...:.|.::.|:..:|....: |:.|.:..|..|..
  Fly    70 RRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYE-KRLSKVDTLKLAIS 133

  Fly   504 YVNSLSHEVCEQEAKIEKLAKQKIELQKRLKQ-----LSLRR---ESPPTDQQIIPQADKAVCLA 560
            |:..||                  |:.|:.|.     |||:|   :.||          |.:   
  Fly   134 YITFLS------------------EMVKKDKNGNEPGLSLQRNYQKEPP----------KKI--- 167

  Fly   561 TTATTAPPTAASGHNGTTILFDAGNACATGQLTTVINKTNGGATAAASSKHNGNHTGGA---TTT 622
                                              ::....||...:.|....|:...|:   ..|
  Fly   168 ----------------------------------ILKDRTGGVAHSLSWYRKGDRYPGSKLYART 198

  Fly   623 LTPAMGIMTIKNGNGSNGNMLAISPTGGHNHQLHQHHNGSPAGSPSGIGATTGATITRGSPTPST 687
            .||.                   .|.|.|:..|..::|                         |.
  Fly   199 WTPE-------------------DPRGPHSQPLPLYNN-------------------------SN 219

  Fly   688 PSPSPSSSSSGVSLSTSFMGGSSSSSSSSSSSSSSSSSS 726
            .:.:.:|:.|    |..|.|..:..|...:::|..||.|
  Fly   220 SNQNQNSNQS----SDDFSGSGADMSDPGAAASIFSSGS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 14/54 (26%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 14/70 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.