DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and Tal1

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:XP_006502972.1 Gene:Tal1 / 21349 MGIID:98480 Length:335 Species:Mus musculus


Alignment Length:375 Identity:74/375 - (19%)
Similarity:120/375 - (32%) Gaps:103/375 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 NGNGLSNGHSSPRS----QLAAAATAHDYEYSAAGVANGHSEGRPHVSEDDNSSINNNNNNNNTH 166
            ||.......::|..    :|.|.:.|.....|..|.|. ..:||..|:.:               
Mouse    41 NGVAKETSRAAPAEPPVIELGARSGAGGGPASGGGAAR-DLKGRDAVAAE--------------- 89

  Fly   167 PPQQQQHSAAGRTTTTRITTTPAILTKLMGNSVTPASNTTSLPTSTPSVTTSPPASTDFMLLAAA 231
                    |..|..||.:...|.     ...:..|||....||.....|..||||      ||| 
Mouse    90 --------ARLRVPTTELCRPPG-----PAPAPAPASAPAELPGDGRMVQLSPPA------LAA- 134

  Fly   232 ATSATSATPATATSAAATAASNPAKRKLSSIAEIPSKFLVVSDAKGVYSAHT----HPNGFAADS 292
                    ||....|...:.|.|       :|.:.|.|....||..:::.:.    .|:.:..: 
Mouse   135 --------PAGPGRALLYSLSQP-------LASLGSGFFGEPDAFPMFTNNNRVKRRPSPYEME- 183

  Fly   293 LGVDNNETMIKKLMQNLQSQRQQQSLQ----QLRSLRPAEISLTPPPAATRKVDISNSRTRSYSL 353
            :....:..:::::..|.:.:.:||::.    :||.|.|..    ||.....|.:|.....:..:.
Mouse   184 ISDGPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTH----PPDKKLSKNEILRLAMKYINF 244

  Fly   354 SNVSAARDQQDHPQHQQHANHMQIQQHYGYMRSNIGGVIYGLHKDSADSAASSACGAGAGAAAVG 418
            .                 |..:..|:..|..|:..|       ||....|.....|.|.....:.
Mouse   245 L-----------------AKLLNDQEEEGTQRAKPG-------KDPVVGAGGGGAGGGIPPEDLL 285

  Fly   419 MSIASSAPAAGSQL----SAHHHTGHGGRRRTTSS-------NSNGAGTR 457
            ..:.|...:.||.|    |...:|.....:.|:.|       .::|||.|
Mouse   286 QDVLSPNSSCGSSLDGAASPDSYTEEPTPKHTSRSLHPALLPAADGAGPR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 1/1 (100%)
Tal1XP_006502972.1 bHLH_TS_TAL1 191..255 CDD:381549 13/84 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.