DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and mxl-3

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_510223.1 Gene:mxl-3 / 181457 WormBaseID:WBGene00003511 Length:235 Species:Caenorhabditis elegans


Alignment Length:169 Identity:40/169 - (23%)
Similarity:72/169 - (42%) Gaps:49/169 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 HKDSADSAASSACGAGAGAAAVGMSIASSAPAAGSQLSAHHHTGHGGRRRTTSSNSNGAGTREVH 460
            |.||:|..:||.              .|::|:......||                        |
 Worm    26 HSDSSDDDSSSP--------------KSASPSMDDDRRAH------------------------H 52

  Fly   461 NKLEKERRAQLKECYDLLKKVLPMGDEDRKKTSNLTILDTAHKYVNSLSHEVCEQEAKIEKLAKQ 525
            |:||:.||..:|:.:.:||..:|:  .|.:|:|...||..|.::::.:..::..|...||.|.::
 Worm    53 NELERRRRDHIKDHFTILKDAIPL--LDGEKSSRALILKRAVEFIHVMQTKLSSQGKAIEDLTRK 115

  Fly   526 KIELQKRLKQLSLRRESPPTDQQIIPQADKAVCLATTAT 564
            ...|::||    |.|||..:     |.:.:...||.:::
 Worm   116 NELLEERL----LERESSGS-----PSSSRLPALAVSSS 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 16/54 (30%)
mxl-3NP_510223.1 bHLHzip_Max 48..116 CDD:381412 22/93 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.