DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and mxl-1

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_505856.1 Gene:mxl-1 / 179557 WormBaseID:WBGene00003509 Length:124 Species:Caenorhabditis elegans


Alignment Length:120 Identity:39/120 - (32%)
Similarity:60/120 - (50%) Gaps:15/120 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 TGHGGRRRTTSSNSNGAGTREVHNKLEKERRAQLKECYDLLKKVLPMGDEDRKKTSNLTILDTAH 502
            |||.|....:.........||.||.||:.||..:|:.|..|::|:|..:.:|.:.|...||..|.
 Worm    12 TGHCGSGEHSGPFDPKRHAREQHNALERRRRDNIKDMYTSLREVVPDANGERVQASRAVILKKAI 76

  Fly   503 KYVN-------SLSHEVCEQEAKIEKLAKQKIELQKRLKQLSLRRESPPTDQQII 550
            :.:.       :||.:|.|||:|..|| :::|   .|||    .::.|.:.|.||
 Worm    77 ESIEKGQSDSATLSVDVAEQESKNAKL-REEI---ARLK----AKKDPSSSQSII 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 20/61 (33%)
mxl-1NP_505856.1 bHLH_SF 31..100 CDD:412148 24/68 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.