DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and Mxi1

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_001008542.2 Gene:Mxi1 / 17859 MGIID:97245 Length:295 Species:Mus musculus


Alignment Length:119 Identity:37/119 - (31%)
Similarity:65/119 - (54%) Gaps:6/119 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 ASSAPAAGSQLSAH----HHTGHGGRRRTTSSNSNGAGTREVHNKLEKERRAQLKECYDLLKKVL 482
            |||.|:..|....|    .......:..:.|||::.| .|..||:|||.|||.|:.|.:.||.::
Mouse    98 ASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTA-NRSTHNELEKNRRAHLRLCLERLKVLI 161

  Fly   483 PMGDEDRKKTSNLTILDTAHKYVNSLSHEVCEQEAKIEKLAKQKIELQKRLKQL 536
            |:|.:..:.|: |.:|:.|..::..|.....:.:.::|.|.:::..|::||:||
Mouse   162 PLGPDCTRHTT-LGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKRRLEQL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 20/54 (37%)
Mxi1NP_001008542.2 HLH 140..192 CDD:197674 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3297
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.