DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and hlh-1

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:NP_001021892.1 Gene:hlh-1 / 173788 WormBaseID:WBGene00001948 Length:324 Species:Caenorhabditis elegans


Alignment Length:262 Identity:54/262 - (20%)
Similarity:93/262 - (35%) Gaps:78/262 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 SLTPPPAATRKVDISN-SRTRSYSLSNVSAARDQQD-------HPQHQQHANHMQIQQHYGYMRS 386
            |..|....|...|.:| :.|||...::|.|..:..|       ..:...:|..:.||..      
 Worm    66 SYAPTAPTTFYSDFANFNVTRSQDFASVPAVANSSDVKPIIIKQEKSTPNATELIIQSR------ 124

  Fly   387 NIGGVIYGLHKDSADSAASSACGAGAGAAAVGMSIASSAPAAGSQLSAHHHTGHGGRRRTTSSNS 451
                 :...|:|:..|.|..|                               |.||.|||....|
 Worm   125 -----VDSQHEDTTTSTAGGA-------------------------------GVGGPRRTKFVLS 153

  Fly   452 NGAGTREVHNKLEKERRAQLKECYDLLK-KVLPMGDEDRKKTSNLTILDTAHKYVNSLSHEVCEQ 515
              ...|:.....|:.|..::.|.::::| :..|   ...::...:.||.:|..|:|:| ..:.:|
 Worm   154 --VDRRKAATMRERRRLRKVNEAFEVVKQRTCP---NPNQRLPKVEILRSAIDYINNL-ERMLQQ 212

  Fly   516 EAKIEKLAKQKIELQKRLKQLSLRRESPPTDQQIIPQADKAVCLATTATTAPPTAASGHNGTTIL 580
            ..|:.|:.:|...|| ..:|::   .:||.|.                .|:...|:|.:|... :
 Worm   213 AGKMTKIMEQNQHLQ-MTQQIN---GAPPHDY----------------VTSSHFASSSYNPEN-M 256

  Fly   581 FD 582
            ||
 Worm   257 FD 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036 12/55 (22%)
hlh-1NP_001021892.1 HLH 153..211 CDD:238036 13/63 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.