DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mnt and htr2b

DIOPT Version :9

Sequence 1:NP_001162651.1 Gene:Mnt / 31331 FlyBaseID:FBgn0023215 Length:790 Species:Drosophila melanogaster
Sequence 2:XP_004914439.1 Gene:htr2b / 101731179 XenbaseID:XB-GENE-989949 Length:478 Species:Xenopus tropicalis


Alignment Length:160 Identity:32/160 - (20%)
Similarity:61/160 - (38%) Gaps:35/160 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 TSATPATATSAAATAASNPAKRKLSSIAEIPSKFLVVSDAKGVYSAHTHPNGFAADSLGVDNNET 300
            |.:|.:|......|..|:|.|   ..:.|.|.|       .|.::       |..:.|.:....:
 Frog   256 TWSTVSTVFQRDMTPGSSPEK---IVMLEGPRK-------DGTFN-------FTGEELPIRRLSS 303

  Fly   301 MIKKLMQNLQSQRQQQSLQQLRSLRPAEISLTPPPAATRKVDISNSRTRSYSLSNVSAARDQQDH 365
            :.||.||.:.:  :|::.:.|..:....:.:..|...|             ::::|...:||.|.
 Frog   304 VGKKSMQTITN--EQRASKVLGIVFFLFVFMWCPFFIT-------------NVTSVLCGKDQCDE 353

  Fly   366 PQHQQHANHMQIQQHYGYMRSNIGGVIYGL 395
            ...:.   .|.|....||:.|.:..::|.|
 Frog   354 DVIKM---LMDIFVWVGYISSGVNPLVYTL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MntNP_001162651.1 HLH 457..512 CDD:238036
htr2bXP_004914439.1 7tm_GPCRs 50..396 CDD:391938 32/160 (20%)
TM helix 1 52..76 CDD:341315
TM helix 2 85..107 CDD:341315
TM helix 3 124..146 CDD:341315
TM helix 4 169..185 CDD:341315
TM helix 5 211..234 CDD:341315
TM helix 6 316..341 CDD:341315 4/37 (11%)
TM helix 7 357..382 CDD:341315 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.