DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and PAPLN

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001352835.1 Gene:PAPLN / 89932 HGNCID:19262 Length:1278 Species:Homo sapiens


Alignment Length:377 Identity:74/377 - (19%)
Similarity:131/377 - (34%) Gaps:95/377 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQNTW--- 107
            :.:.:.:..:|.||.......|...||:.....:...:||....::..:.....:...|..|   
Human   882 QELGSRAPGLGGDAGSPAPPFHSSSYRISLAGVEPSLVQAALGQLVRLSCSDDTAPESQAAWQKD 946

  Fly   108 ---------------NLHIKAVSEEDRGGYMC---QLNTDPMKSQIGFL--DVVI---------- 142
                           :|.|..:..||.|.|.|   :...|..|.|:..:  |:.:          
Human   947 GQPISSDRHRLQFDGSLIIHPLQAEDAGTYSCGSTRPGRDSQKIQLRIIGGDMAVLSEAELSRFP 1011

  Fly   143 ---------------------------PPDFISEDTSSDVIV--PEGSSVRLTCRARGYPEPIVT 178
                                       |.:.:..|.:...:|  ..|..:|:||||.|:|.|.:.
Human  1012 QPRDPAQDFGQAGAAGPLGAIPSSHPQPANRLRLDQNQPRVVDASPGQRIRMTCRAEGFPPPAIE 1076

  Fly   179 WRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNG-------VPPSVSKRI 236
            |:| ||..:    :.....|.|.  |. |.:|:::..:.|.|.|:|.||       |...|...:
Human  1077 WQR-DGQPV----SSPRHQLQPD--GS-LVISRVAVEDGGFYTCVAFNGQDRDQRWVQLRVLGEL 1133

  Fly   237 SLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQSMY 301
            ::| ...|.:.||.       |...::.|.|  :.:|:|......|..:...| :.|.:|...  
Human  1134 TIS-GLPPTVTVPE-------GDTARLLCVV--AGESVNIRWSRNGLPVQADG-HRVHQSPDG-- 1185

  Fly   302 ETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRNKNPLNGG 353
                ::::...:..|.|||.|.|......|..|..: ::..|.....|.:.|
Human  1186 ----TLLIYNLRARDEGSYTCSAYQGSQAVSRSTEV-KVVSPAPTAQPRDPG 1232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 17/100 (17%)
Ig 51..131 CDD:299845 18/100 (18%)
I-set 144..240 CDD:254352 28/104 (27%)
IGc2 159..228 CDD:197706 24/75 (32%)
Ig 244..337 CDD:299845 20/92 (22%)
I-set 244..337 CDD:254352 20/92 (22%)
PAPLNNP_001352835.1 TSP1 29..80 CDD:214559
ADAM_spacer1 183..298 CDD:310520
TSP1 308..361 CDD:214559
TSP1 369..424 CDD:214559
TSP1 424..481 CDD:214559
TSP1 488..539 CDD:214559
Kunitz_BPTI 753..805 CDD:278443
Papilin_u7 814..905 CDD:318767 4/22 (18%)
Ig 914..>978 CDD:325142 10/63 (16%)
I-set 1049..1119 CDD:254352 25/77 (32%)
IG 1139..1219 CDD:214652 20/96 (21%)
PLAC 1235..1267 CDD:312271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.