Sequence 1: | NP_001259218.1 | Gene: | DIP-alpha / 31322 | FlyBaseID: | FBgn0052791 | Length: | 554 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038964701.1 | Gene: | Chl1 / 89828 | RGDID: | 620122 | Length: | 1224 | Species: | Rattus norvegicus |
Alignment Length: | 521 | Identity: | 107/521 - (20%) |
---|---|---|---|
Similarity: | 180/521 - (34%) | Gaps: | 177/521 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 PEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADT-----KAIQAIHENVITHNPRVTVSH 101
Fly 102 LDQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVI--PPDFISEDTSSDVIVPEGSSVR 164
Fly 165 LTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEV-----LKLSKISRNEMGSYLCIA 224
Fly 225 SNGVPPSVSKRISLS-IHFHPVIQVPN-QLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVT 287
Fly 288 SGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLG--------EVDSSIRLYEIPGPN 344
Fly 345 RNKNP------------------------------------LNGGGKG----GGAG--------- 360
Fly 361 -------------------------GSLDADANDILKQKQ--QVKVTYQPEDEE----LQYGSVE 394
Fly 395 DFEA---EGGEGGGLT-----------PLSPHVYY----TSGNKPATHKPGNSGGNQHLHQQHHH 441
Fly 442 H 442 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-alpha | NP_001259218.1 | IG_like | 49..129 | CDD:214653 | 21/84 (25%) |
Ig | 51..131 | CDD:299845 | 20/84 (24%) | ||
I-set | 144..240 | CDD:254352 | 22/101 (22%) | ||
IGc2 | 159..228 | CDD:197706 | 20/73 (27%) | ||
Ig | 244..337 | CDD:299845 | 22/101 (22%) | ||
I-set | 244..337 | CDD:254352 | 22/101 (22%) | ||
Chl1 | XP_038964701.1 | Ig | 34..125 | CDD:416386 | |
Ig strand A | 34..38 | CDD:409353 | |||
Ig strand A' | 43..47 | CDD:409353 | |||
Ig strand B | 52..59 | CDD:409353 | |||
Ig strand C | 65..70 | CDD:409353 | |||
Ig strand C' | 73..75 | CDD:409353 | |||
Ig strand D | 81..84 | CDD:409353 | |||
Ig strand E | 89..93 | CDD:409353 | |||
Ig strand F | 104..112 | CDD:409353 | |||
Ig strand G | 115..125 | CDD:409353 | |||
IgI_2_L1-CAM_like | 134..224 | CDD:409432 | |||
Ig strand B | 148..152 | CDD:409432 | |||
Ig strand C | 162..166 | CDD:409432 | |||
Ig strand E | 185..189 | CDD:409432 | |||
Ig strand F | 200..205 | CDD:409432 | |||
Ig strand G | 216..219 | CDD:409432 | |||
Ig | 261..343 | CDD:416386 | 25/100 (25%) | ||
Ig strand B | 273..277 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 286..290 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 308..312 | CDD:409353 | 1/21 (5%) | ||
Ig strand F | 322..327 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 335..338 | CDD:409353 | 0/2 (0%) | ||
Ig4_L1-NrCAM_like | 347..434 | CDD:409367 | 21/100 (21%) | ||
Ig strand B | 363..367 | CDD:409367 | 1/3 (33%) | ||
Ig strand C | 376..380 | CDD:409367 | 0/3 (0%) | ||
Ig strand E | 399..403 | CDD:409367 | 0/3 (0%) | ||
Ig strand F | 413..418 | CDD:409367 | 2/4 (50%) | ||
Ig strand G | 426..429 | CDD:409367 | 0/2 (0%) | ||
Ig | 447..524 | CDD:416386 | 18/84 (21%) | ||
Ig strand A' | 447..451 | CDD:409353 | 0/3 (0%) | ||
Ig strand B | 454..463 | CDD:409353 | 1/8 (13%) | ||
Ig strand C | 469..474 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 477..480 | CDD:409353 | 0/2 (0%) | ||
Ig strand D | 485..490 | CDD:409353 | 2/4 (50%) | ||
Ig strand E | 491..498 | CDD:409353 | 0/14 (0%) | ||
Ig strand F | 505..513 | CDD:409353 | 4/7 (57%) | ||
Ig strand G | 516..524 | CDD:409353 | 1/7 (14%) | ||
Ig | 528..627 | CDD:416386 | 11/103 (11%) | ||
Ig strand A | 528..534 | CDD:409353 | 1/5 (20%) | ||
Ig strand A' | 537..542 | CDD:409353 | 3/4 (75%) | ||
Ig strand B | 545..553 | CDD:409353 | 0/7 (0%) | ||
Ig strand C | 564..568 | CDD:409353 | 0/3 (0%) | ||
Ig strand D | 583..586 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 589..593 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 602..609 | CDD:409353 | 0/6 (0%) | ||
Ig strand G | 616..620 | CDD:409353 | 0/3 (0%) | ||
FN3 | 627..716 | CDD:238020 | 23/99 (23%) | ||
fn3 | 730..811 | CDD:394996 | |||
FN3 | 832..926 | CDD:238020 | |||
FN3 | 931..1026 | CDD:238020 | |||
Bravo_FIGEY | 1120..1201 | CDD:404722 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR12231 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |