DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr21

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:225 Identity:57/225 - (25%)
Similarity:100/225 - (44%) Gaps:23/225 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PEF-VESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVT-VSHLDQ 104
            |.| ..:..||:..||......|.:::||...|.|::.....:..:.|:..|.:.|.| :.:...
  Fly    51 PYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQT 115

  Fly   105 NTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDV--VIPPDFISEDTSSDVIVPEGSSVRLTC 167
            ..|:|.||.....|.|.|.||::|.|   .:|:..|  |:.| ..|.....::.:..||:|.|||
  Fly   116 GDWSLQIKFPQLRDSGIYECQVSTTP---PVGYTMVFSVVEP-ITSILGGPEIYIDLGSTVNLTC 176

  Fly   168 RARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEV----LKLSKISRNEMGSYLCIASNGV 228
            ..:..|:|.::.:....|:.:..|:........:.:|::    |.:.:.|..:.|.|.|:.||..
  Fly   177 VIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNAN 241

  Fly   229 PPSVSKRISLSIHF----HP-VIQVPNQLV 253
            ..||      ::|.    || .:|..:.||
  Fly   242 SKSV------NVHILKGDHPAAVQKSHLLV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 22/80 (28%)
Ig strand B 59..63 CDD:409353 0/3 (0%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 2/7 (29%)
Ig 152..240 CDD:472250 20/91 (22%)
Ig strand B 163..167 CDD:409275 2/3 (67%)
Ig strand C 176..180 CDD:409275 0/3 (0%)
Ig strand E 205..209 CDD:409275 1/7 (14%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 4/11 (36%)
Ig strand B 261..265 CDD:409353
Ig strand C 274..278 CDD:409353
Ig strand E 305..309 CDD:409353
Ig strand F 319..324 CDD:409353
Ig strand G 332..335 CDD:409353
dpr21NP_001163838.2 Ig 71..149 CDD:472250 21/80 (26%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 118..122 CDD:409353 2/3 (67%)
Ig strand F 132..137 CDD:409353 2/4 (50%)
Ig 169..249 CDD:472250 20/85 (24%)
Ig strand B 172..176 CDD:409353 2/3 (67%)
Ig strand C 187..191 CDD:409353 0/3 (0%)
Ig strand E 218..222 CDD:409353 1/3 (33%)
Ig strand F 232..237 CDD:409353 2/4 (50%)
Ig strand G 246..249 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.