DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and KIRREL3

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_011541328.1 Gene:KIRREL3 / 84623 HGNCID:23204 Length:809 Species:Homo sapiens


Alignment Length:403 Identity:92/403 - (22%)
Similarity:156/403 - (38%) Gaps:107/403 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AKRLLRNFQFTSCDRNGKMLIHLLLIVSLLEAIGAFQPEFVES-------ISNVSVAVGRDATFT 62
            :|.|||       |...:.::..|.|          .|..||:       .:|.::..|::.:.|
Human   202 SKTLLR-------DGKRESIVSTLFI----------SPGDVENGQSIVCRATNKAIPGGKETSVT 249

  Fly    63 CHVRHLGGYRVGWLKADTKAIQAIHENVITH------NPRVTVSHLDQNTWNLHIKAVSEEDRGG 121
            ..::|     ...:....:....:.:||:|.      ||.||     |..|....:.:.|.....
Human   250 IDIQH-----PPLVNLSVEPQPVLEDNVVTFHCSAKANPAVT-----QYRWAKRGQIIKEASGEV 304

  Fly   122 YMCQLN----TDPMKSQI----------GFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGY 172
            |...::    ::|:..::          ..:||...|...:|..|  ::|..||....:|...|.
Human   305 YRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQS--LLVDLGSDAIFSCAWTGN 367

  Fly   173 PEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPSV---SK 234
            |...:.|.:. |:.:||.:.   |||.         |..:.:.:.|.|:|.|   |.|.|   .:
Human   368 PSLTIVWMKR-GSGVVLSNE---KTLT---------LKSVRQEDAGKYVCRA---VVPRVGAGER 416

  Fly   235 RISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINY---W---IKDTGEMIVTSGKYHV 293
            .::|:::..|:|. ..|...|..|...||:|.:.::|.....   |   :.::|    |||:|.|
Human   417 EVTLTVNGPPIIS-STQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESG----TSGRYTV 476

  Fly   294 Q--ESSQSMYET-KMSMIVR-KFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRNKNPLNGGG 354
            :  .:.:.:..| .:|.||| .||.    .|.|.|.||.|.....|||.|           .|..
Human   477 ETISTEEGVISTLTISNIVRADFQT----IYNCTAWNSFGSDTEIIRLKE-----------QGSE 526

  Fly   355 KGGGAGGSLDADA 367
            ...|||  |:|::
Human   527 MKSGAG--LEAES 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 15/89 (17%)
Ig 51..131 CDD:299845 14/89 (16%)
I-set 144..240 CDD:254352 25/98 (26%)
IGc2 159..228 CDD:197706 17/68 (25%)
Ig 244..337 CDD:299845 30/102 (29%)
I-set 244..337 CDD:254352 30/102 (29%)
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845
IG_like 60..149 CDD:214653
I-set 156..249 CDD:254352 12/63 (19%)
Ig2_KIRREL3-like 171..252 CDD:143236 13/66 (20%)
Ig_2 260..337 CDD:290606 12/81 (15%)
I-set 341..422 CDD:254352 25/98 (26%)
IGc2 355..406 CDD:197706 16/63 (25%)
Ig5_KIRREL3 424..521 CDD:143306 31/105 (30%)
IG_like 432..521 CDD:214653 29/96 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.