DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and ntm

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001003852.2 Gene:ntm / 678534 ZFINID:ZDB-GENE-060421-6020 Length:375 Species:Danio rerio


Alignment Length:392 Identity:95/392 - (24%)
Similarity:164/392 - (41%) Gaps:91/392 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ESISNVSVAVGRDATFTC----HVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQNT 106
            :.:.|:::..|.....:|    .|.|     ..||  :..:|....|:..:.:|||::..|.|..
Zfish    35 KQMDNITIRQGETLFLSCSQGDFVTH-----TAWL--NRSSILYAGEDKWSVDPRVSLVTLSQEE 92

  Fly   107 WNLHIKAVSEEDRGGYMCQLNTD--PMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRA 169
            :.:.|:.|...|.|.|:|.:.|.  |..:.:..: |.:||..:  :.|.|::|.|||:|.|.|.|
Zfish    93 FTIKIEDVDVTDEGQYICAVQTSSRPRTTSVHII-VQVPPKIV--NLSRDLVVNEGSNVTLMCLA 154

  Fly   170 RGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSK 234
            .|.|||.:.||.:..::..|..:           .|||.:..|||...|.|.|.|:|.:... ::
Zfish   155 NGKPEPAIVWRMKSPSDDSLSSD-----------SEVLDIPFISRYRAGVYECTAANDIAVD-TQ 207

  Fly   235 RISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKD--------TGEMIVTSGK- 290
            .:.|::::.|.:. ..:.||..||....::|..:|.|::...|.:|        .|..|..:|. 
Zfish   208 TVELTVNYAPSVS-DGRDVGVTLGQRGVLQCEADAVPEADFEWYRDDRRIFNGLDGIEIEAAGAL 271

  Fly   291 -----YHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRN---- 346
                 ::|.|:                   |.|:|.|:|.|.||..::|..||||..|..:    
Zfish   272 SRLTFFNVSEA-------------------DYGNYTCVAINKLGSANTSFVLYEIIEPTSSTLLQ 317

  Fly   347 --KNPLNGGGKGGGAGGSLDADANDILKQKQQVKVTYQPEDEELQYGSVEDFEAEGGEGGGLTPL 409
              .:|           ..|:..::|:.:...|..:...|       |:|:|     |..|..|..
Zfish   318 VETSP-----------SVLEMTSSDLEQTPLQNDLWEGP-------GAVQD-----GNSGTSTVF 359

  Fly   410 SP 411
            :|
Zfish   360 NP 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 20/83 (24%)
Ig strand B 59..63 CDD:409353 0/3 (0%)
Ig strand C 72..76 CDD:409353 0/3 (0%)
Ig strand E 103..111 CDD:409353 1/7 (14%)
Ig 152..240 CDD:472250 29/87 (33%)
Ig strand B 163..167 CDD:409275 2/3 (67%)
Ig strand C 176..180 CDD:409275 0/3 (0%)
Ig strand E 205..209 CDD:409275 3/3 (100%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 24/106 (23%)
Ig strand B 261..265 CDD:409353 0/3 (0%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353 0/2 (0%)
ntmNP_001003852.2 Ig 39..127 CDD:472250 22/95 (23%)
Ig strand B 48..52 CDD:409353 0/3 (0%)
Ig strand C 60..64 CDD:409353 1/8 (13%)
Ig strand E 93..97 CDD:409353 0/3 (0%)
Ig strand F 107..112 CDD:409353 2/4 (50%)
Ig strand G 120..123 CDD:409353 0/2 (0%)
Ig_3 130..200 CDD:464046 29/82 (35%)
Ig 223..304 CDD:472250 23/99 (23%)
Ig strand B 233..237 CDD:409353 0/3 (0%)
Ig strand C 246..250 CDD:409353 0/3 (0%)
Ig strand E 272..276 CDD:409353 0/3 (0%)
Ig strand F 286..291 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.