DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and Tmigd1

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001369175.1 Gene:Tmigd1 / 66601 MGIID:1913851 Length:294 Species:Mus musculus


Alignment Length:259 Identity:58/259 - (22%)
Similarity:110/259 - (42%) Gaps:48/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 IHENVITHNPRVTVSHLDQNTWNLH-IKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISE 149
            :|:.::..:...|.....:.: ||| :|.|.:.......|||....:....|....|:..:..:|
Mouse     7 VHKLIVEQSTETTAFFASRRS-NLHSLKMVWKITGPLQACQLLLVVLSLPQGRTSSVLTVNGRTE 70

  Fly   150 DTSSDVIVPEGSSVRLTCRARGYPE-PIVTWRREDGNEIV-LKDNVGTKTLAPSFRGEVLKLSKI 212
            :...|  ...|....|.|..:.:.| ..:.|.||||  || ||:            |..:.:|.:
Mouse    71 NYILD--TQHGVQASLECAVQNHTEDEELLWYREDG--IVDLKN------------GNKINISSV 119

  Fly   213 SRNEMGSYLCI-----ASNGV--------PPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIE 264
                     |:     :.|||        ..:||..:.|::.|.|::. .|........:||.:.
Mouse   120 ---------CVSPINESDNGVRFTCKLQRDQTVSVTVVLNVTFPPLLS-GNGFQTVEENSDVSLV 174

  Fly   265 CHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSL 328
            |:|:::|::...|.|:...:::..|::.:.::.:|     ..:.:.|.:|.|.|:|.|||.:||
Mouse   175 CNVKSNPQAQMMWYKNNSALVLEKGRHQIHQTRES-----FQLSITKVKKSDNGTYSCIASSSL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 10/43 (23%)
Ig strand B 59..63 CDD:409353
Ig strand C 72..76 CDD:409353
Ig strand E 103..111 CDD:409353 3/8 (38%)
Ig 152..240 CDD:472250 23/102 (23%)
Ig strand B 163..167 CDD:409275 1/3 (33%)
Ig strand C 176..180 CDD:409275 0/3 (0%)
Ig strand E 205..209 CDD:409275 0/3 (0%)
Ig strand F 219..224 CDD:409275 1/9 (11%)
Ig strand G 233..236 CDD:409275 1/2 (50%)
Ig 244..337 CDD:472250 21/85 (25%)
Ig strand B 261..265 CDD:409353 1/3 (33%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353
Tmigd1NP_001369175.1 IG_like 163..244 CDD:214653 19/76 (25%)
Ig strand B 171..175 CDD:409353 1/3 (33%)
Ig strand C 184..188 CDD:409353 0/3 (0%)
Ig strand E 210..214 CDD:409353 0/3 (0%)
Ig strand F 224..229 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.