DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and igsf9bb

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_068072154.1 Gene:igsf9bb / 569554 ZFINID:ZDB-GENE-091112-15 Length:1448 Species:Danio rerio


Alignment Length:421 Identity:110/421 - (26%)
Similarity:160/421 - (38%) Gaps:81/421 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QPEFVESISNVSVAVGRDATFTCHVRH-LGG--YRVGWLKADTKAIQAIHENVITHNPRVTVSHL 102
            :|:||.|.:..:|.:|      |.|.| |.|  |.|.|.|........|       |.|....|:
Zfish    29 EPQFVTSRAGETVILG------CDVVHPLNGQPYVVEWFKFGVPIPFFI-------NFRFYPPHV 80

  Fly   103 D---------QNTWNLHIKAVSEEDRGGYMC-------QLNTDPMKSQIGFLDVVIPPDFISEDT 151
            |         ....:|.|:.|..||:|.|.|       |.:|....|.: .|.|..||.|  .||
Zfish    81 DPEYAGRASLHGKSSLRIERVRSEDQGWYECKVLMLEQQYHTFHNGSWV-HLTVNAPPTF--TDT 142

  Fly   152 SSDVI-VPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRN 215
            ....: ..||.|:.|:|.|.|.|:|.|:|.|| ||.:  :|:...|....|     |.|..|||.
Zfish   143 PPQYVEAKEGGSITLSCTAFGNPKPSVSWLRE-GNPV--QDSTKYKVSDGS-----LTLVSISRE 199

  Fly   216 EMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINY---W 277
            :.|:|.|.|.:....:| ....|.:...|.|..|.:.:...:..|....|..||.|.::.|   |
Zfish   200 DRGAYTCRAYSEQGEAV-HTTRLLVQGPPFIVSPPENITVNISQDAFFTCQAEAYPGNLTYTWFW 263

  Fly   278 IKDT---------GEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDS 333
            .:|.         ...|:..|                |:|:.:.:.:|.|.|.|...||||...|
Zfish   264 EEDNVFFKNDLKRRVSILIDG----------------SLIISQVKPEDAGKYTCSPSNSLGRPPS 312

  Fly   334 SIRLYEIPGPNR--NKNPLNGGGKGGGAGGSLDADAN---DILKQKQQ---VKVTYQPEDEELQY 390
            :.....:..|.|  |..|:.....|.........|||   ..:|.|:.   :::...|...:::.
Zfish   313 ASAYLTVHYPARVINMPPVIYVAIGLPGYIRCPVDANPPVTSVKWKKDGLPLRIEKYPGWSQMED 377

  Fly   391 GSVEDFEAEGGEGGGLTPLSPHVYYTSGNKP 421
            ||:...|......|..|.:..:...|.|..|
Zfish   378 GSIRVSEVTEDSLGTYTCVPYNSLGTMGPSP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 25/98 (26%)
Ig strand B 59..63 CDD:409353 0/3 (0%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 2/16 (13%)
Ig 152..240 CDD:472250 29/88 (33%)
Ig strand B 163..167 CDD:409275 1/3 (33%)
Ig strand C 176..180 CDD:409275 1/3 (33%)
Ig strand E 205..209 CDD:409275 1/3 (33%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 24/104 (23%)
Ig strand B 261..265 CDD:409353 0/3 (0%)
Ig strand C 274..278 CDD:409353 1/6 (17%)
Ig strand E 305..309 CDD:409353 1/3 (33%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353 1/2 (50%)
igsf9bbXP_068072154.1 Ig 41..113 CDD:409353 24/84 (29%)
Ig strand B 41..45 CDD:409353 2/9 (22%)
Ig strand C 57..61 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 1/3 (33%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
IG_like 144..223 CDD:214653 29/87 (33%)
Ig strand B 155..159 CDD:409353 1/3 (33%)
Ig strand C 168..172 CDD:409353 1/3 (33%)
Ig strand E 189..193 CDD:409353 2/8 (25%)
Ig strand F 203..208 CDD:409353 2/4 (50%)
Ig strand G 216..219 CDD:409353 1/3 (33%)
Ig 227..319 CDD:472250 24/107 (22%)
Ig strand B 244..248 CDD:409353 0/3 (0%)
Ig strand C 258..262 CDD:409353 1/3 (33%)
Ig strand E 284..288 CDD:409353 2/19 (11%)
Ig strand F 298..303 CDD:409353 2/4 (50%)
Ig strand G 312..315 CDD:409353 1/2 (50%)
Ig <343..403 CDD:472250 11/59 (19%)
Ig strand C 353..358 CDD:409353 1/4 (25%)
Ig strand E 378..382 CDD:409353 2/3 (67%)
Ig strand F 392..397 CDD:409353 1/4 (25%)
Ig 427..504 CDD:472250
Ig strand B 436..440 CDD:409353
Ig strand C 449..453 CDD:409353
Ig strand E 470..474 CDD:409353
Ig strand F 484..489 CDD:409353
FN3 <489..>734 CDD:442628
Ig strand G 497..500 CDD:409353
FN3 509..604 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.