DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dscama

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_021334866.1 Gene:dscama / 568643 ZFINID:ZDB-GENE-050310-7 Length:2025 Species:Danio rerio


Alignment Length:468 Identity:101/468 - (21%)
Similarity:177/468 - (37%) Gaps:125/468 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EAIGAF---QP-EFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNP 95
            |.||..   :| :.|.|...|..:||...:.:|.|.....:.:.|.:...|         |....
Zfish   304 EVIGRLTVKEPLKAVVSPRKVKGSVGSQVSLSCSVTGSDEFELSWYRNGDK---------INTGA 359

  Fly    96 RVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVI---PPDFISEDTSSDVIV 157
            .:.::.:  |..||.:..:::.|.|.|.|......|.:| .|:.|::   .|..:|  ..|:.:|
Zfish   360 NIRMNGI--NKENLVMDGMAKSDGGVYQCFSRKAKMSAQ-DFVQVILEDGTPKILS--AFSEKVV 419

  Fly   158 PEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEV---LKLSKISRNEMGS 219
            .....|.|||..:|.|:|.:||..:|  |:|.||:......:.:..|.|   |.:|.|...:.|.
Zfish   420 GPNDFVSLTCHVKGTPQPAITWTLDD--EVVAKDSRHRIVHSITAEGNVVSYLNISHIQVRDSGV 482

  Fly   220 YLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTG-- 282
            |.|..:|.. .:||.:..:::.....|: |.:.:.|..|.|:.|.|||...|.....|.|::.  
Zfish   483 YRCTCNNSA-GTVSYQARINVRGSADIR-PMKNLTAIAGWDMYIHCHVIGYPYYSIKWFKNSNLL 545

  Fly   283 --------------------EMIVTSGKY--HVQESSQSMYETKMSMIVR--------KFQKDDV 317
                                :..:..|:|  |||...|......:.:.|:        :|.:..:
Zfish   546 PFNDRQRAFENNGTLKLLNVQKELDEGEYSCHVQVQPQLFKNQSVHVTVKVPPFIQPFEFPRYSI 610

  Fly   318 GSYR----CIAKN------------------SLG------EVDSSIRLYEIPGPNRNKNPLNGGG 354
            | :|    |:.::                  |||      :..||:|:..:   .|..|      
Zfish   611 G-HRVFVPCVVRSGDLPISITWEKDGKSINASLGVTIDNIDFTSSLRISNL---QRVHN------ 665

  Fly   355 KGGGAGGSLDADA-ND--ILKQKQQV------KVTYQPEDEELQYGS--VEDFEAEG-------- 400
                  |:....| ||  ::|.:.|:      :...||:|::..||.  :.:..|:|        
Zfish   666 ------GTYTCIAQNDAAVVKYQSQLIVRVPPRFKVQPQDQDGIYGKSVILNCSADGEPRPTIEW 724

  Fly   401 --GEGGGLTPLSP 411
              .:|.|:....|
Zfish   725 KYSKGAGVPQFQP 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 15/79 (19%)
Ig 51..131 CDD:299845 15/79 (19%)
I-set 144..240 CDD:254352 29/98 (30%)
IGc2 159..228 CDD:197706 23/71 (32%)
Ig 244..337 CDD:299845 28/152 (18%)
I-set 244..337 CDD:254352 28/152 (18%)
dscamaXP_021334866.1 Ig 124..217 CDD:325142
I-set 236..311 CDD:254352 3/6 (50%)
IG_like 321..402 CDD:214653 18/92 (20%)
I-set 408..502 CDD:333254 29/98 (30%)
IGc2 524..579 CDD:197706 10/54 (19%)
Ig 614..679 CDD:319273 13/79 (16%)
Ig_DSCAM 708..787 CDD:143211 5/30 (17%)
Ig 805..898 CDD:325142
FN3 894..988 CDD:238020
FN3 995..1092 CDD:238020
fn3 1100..1186 CDD:306538
fn3 1199..1282 CDD:306538
Ig 1312..1377 CDD:319273
fn3 1405..1471 CDD:306538
FN3 1492..1563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.