| Sequence 1: | NP_001259218.1 | Gene: | DIP-alpha / 31322 | FlyBaseID: | FBgn0052791 | Length: | 554 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_696022.6 | Gene: | aebp1b / 567630 | ZFINID: | ZDB-GENE-030131-8546 | Length: | 1247 | Species: | Danio rerio |
| Alignment Length: | 244 | Identity: | 57/244 - (23%) |
|---|---|---|---|
| Similarity: | 91/244 - (37%) | Gaps: | 60/244 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 198 LAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQ 262
Fly 263 IECHVEASPKSINYWIKDTGEMIVTSG---KYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIA 324
Fly 325 KNSLGEVDSSIRLYEI-------------------PGPNR-------NKNPLN----GGGKGGGA 359
Fly 360 GGSLDADANDILKQKQQVKVT---------YQPEDEELQYGSVEDFEAE 399 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-alpha | NP_001259218.1 | IG_like | 49..129 | CDD:214653 | |
| Ig | 51..131 | CDD:299845 | |||
| I-set | 144..240 | CDD:254352 | 11/41 (27%) | ||
| IGc2 | 159..228 | CDD:197706 | 9/29 (31%) | ||
| Ig | 244..337 | CDD:299845 | 23/95 (24%) | ||
| I-set | 244..337 | CDD:254352 | 23/95 (24%) | ||
| aebp1b | XP_696022.6 | Ig | 56..147 | CDD:299845 | 24/97 (25%) |
| IG_like | 62..145 | CDD:214653 | 23/89 (26%) | ||
| FA58C | 402..555 | CDD:238014 | |||
| FA58C | 403..556 | CDD:214572 | |||
| Peptidase_M14_like | 577..1036 | CDD:299699 | |||
| Peptidase_M14NE-CP-C_like | 1040..1115 | CDD:200604 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||