DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and tmigd1

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001091718.3 Gene:tmigd1 / 559127 ZFINID:ZDB-GENE-080303-6 Length:249 Species:Danio rerio


Alignment Length:250 Identity:58/250 - (23%)
Similarity:103/250 - (41%) Gaps:40/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KMLIHLLLIVSLLEAIGAFQPEFVESI-----SNVSVAVGRDATFTCHVRHL---GGYRVGWLKA 78
            |:|:.:.|:  ||..:...:...|||.     |.:..||....|.||...:.   ....:.|.:.
Zfish     2 KVLVRVALL--LLCCVSCVKAVTVESCPLAVGSLLQTAVEETVTLTCMTDNTDPSSQQELQWFRN 64

  Fly    79 DTKAIQAIHENVITHNPRVTVSHLDQNTWNLHIKAVSEEDRGG-YMCQLNTDPMKSQIGFLDVVI 142
            ..: ::...||:::.:             :|.::.|::||.|. :.|||..|...:.....||..
Zfish    65 GAR-VKLPEENMMSRS-------------SLCVQPVTKEDDGAVFTCQLKGDASVNSTVEFDVRY 115

  Fly   143 PPDFISEDTSSDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVL 207
            |||.  .|| ::|.|.|.:...|:|..|..|...|.|:: ||.  ||....|:.....:.....|
Zfish   116 PPDL--NDT-TEVFVQETNDAVLSCEVRANPPVTVVWKK-DGE--VLDLTTGSYKSTNNGITAQL 174

  Fly   208 KLSKISRN-EMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDV 261
            .:.|:.|: ..|.|:|...:.:.....:...        :.|.::::|.|||..:
Zfish   175 TIPKLKRDVHQGLYVCETKSAMYGVTGRTFQ--------VTVEDRVIGFPLGPTI 221

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 17/83 (20%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 0/3 (0%)
Ig strand E 103..111 CDD:409353 1/7 (14%)
Ig 152..240 CDD:472250 20/88 (23%)
Ig strand B 163..167 CDD:409275 1/3 (33%)
Ig strand C 176..180 CDD:409275 1/3 (33%)
Ig strand E 205..209 CDD:409275 1/3 (33%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 5/17 (29%)