DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and Ntm

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001418383.1 Gene:Ntm / 50864 RGDID:620958 Length:367 Species:Rattus norvegicus


Alignment Length:342 Identity:98/342 - (28%)
Similarity:159/342 - (46%) Gaps:39/342 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LEAIGAFQ--------PEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENV 90
            |.|:..||        ..|.:::.||:|..|..||..|.:.: ...||.||...|  |.....:.
  Rat    20 LAALCLFQGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDN-RVTRVAWLNRST--ILYAGNDK 81

  Fly    91 ITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTD--PMKSQIGFLDVVIPPDFISEDTSS 153
            ...:|||.:....|..:::.|:.|...|.|.|.|.:.||  |..|:: .|.|.:.|..:  :.||
  Rat    82 WCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRV-HLIVQVSPKIV--EISS 143

  Fly   154 DVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMG 218
            |:.:.||:::.|||.|.|.|||.||||           ::..|.:......|.|::..|:|.:.|
  Rat   144 DISINEGNNISLTCIATGRPEPTVTWR-----------HISPKAVGFVSEDEYLEIQGITREQSG 197

  Fly   219 SYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGE 283
            .|.|.|||.|...|.:|:.:::::.|.|..... .|.|:|....::|...|.|.:...|.||...
  Rat   198 EYECSASNDVAAPVVRRVKVTVNYPPYISEAKG-TGVPVGQKGTLQCEASAVPSAEFQWFKDDKR 261

  Fly   284 MIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRN-- 346
            ::  .||..|:..::. :.::::..  ...:.|.|:|.|:|.|.||..::||.|:|:..|..:  
  Rat   262 LV--EGKKGVKVENRP-FLSRLTFF--NVSEHDYGNYTCVASNKLGHTNASIMLFELNEPTSSTL 321

  Fly   347 ----KNPLNGGGKGGGA 359
                |.......||.||
  Rat   322 LQEVKTTALTPWKGPGA 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 23/79 (29%)
Ig strand B 59..63 CDD:409353 2/3 (67%)
Ig strand C 72..76 CDD:409353 2/3 (67%)
Ig strand E 103..111 CDD:409353 1/7 (14%)
Ig 152..240 CDD:472250 31/87 (36%)
Ig strand B 163..167 CDD:409275 1/3 (33%)
Ig strand C 176..180 CDD:409275 2/3 (67%)
Ig strand E 205..209 CDD:409275 2/3 (67%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 24/92 (26%)
Ig strand B 261..265 CDD:409353 0/3 (0%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353 0/2 (0%)
NtmNP_001418383.1 Ig 44..132 CDD:472250 28/91 (31%)
Ig strand B 53..57 CDD:409382 2/3 (67%)
Ig strand C 65..69 CDD:409382 2/3 (67%)
Ig strand E 98..102 CDD:409382 0/3 (0%)
Ig strand F 112..117 CDD:409382 2/4 (50%)
Ig strand G 125..128 CDD:409382 1/2 (50%)
Ig_3 136..205 CDD:464046 27/81 (33%)
Ig 223..307 CDD:472250 22/89 (25%)
Ig strand B 239..243 CDD:409408 0/3 (0%)
Ig strand C 252..256 CDD:409408 0/3 (0%)
Ig strand E 278..282 CDD:409408 0/3 (0%)
Ig strand F 292..297 CDD:409408 2/4 (50%)

Return to query results.
Submit another query.