Sequence 1: | NP_001259218.1 | Gene: | DIP-alpha / 31322 | FlyBaseID: | FBgn0052791 | Length: | 554 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001338930.1 | Gene: | NTM / 50863 | HGNCID: | 17941 | Length: | 367 | Species: | Homo sapiens |
Alignment Length: | 342 | Identity: | 100/342 - (29%) |
---|---|---|---|
Similarity: | 156/342 - (45%) | Gaps: | 39/342 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 LEAIGAFQ--------PEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENV 90
Fly 91 ITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTD--PMKSQIGFLDVVIPPDFISEDTSS 153
Fly 154 DVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMG 218
Fly 219 SYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGE 283
Fly 284 MIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRN-- 346
Fly 347 ----KNPLNGGGKGGGA 359 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-alpha | NP_001259218.1 | IG_like | 49..129 | CDD:214653 | 23/79 (29%) |
Ig | 51..131 | CDD:299845 | 24/81 (30%) | ||
I-set | 144..240 | CDD:254352 | 32/95 (34%) | ||
IGc2 | 159..228 | CDD:197706 | 25/68 (37%) | ||
Ig | 244..337 | CDD:299845 | 26/92 (28%) | ||
I-set | 244..337 | CDD:254352 | 26/92 (28%) | ||
NTM | NP_001338930.1 | Ig | 44..132 | CDD:416386 | 28/91 (31%) |
Ig strand A' | 44..49 | CDD:409353 | 3/4 (75%) | ||
Ig strand B | 51..59 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 59..63 | CDD:409353 | 0/4 (0%) | ||
FR2 | 64..70 | CDD:409353 | 3/5 (60%) | ||
Ig strand C | 64..70 | CDD:409353 | 3/5 (60%) | ||
CDR2 | 71..83 | CDD:409353 | 2/13 (15%) | ||
Ig strand C' | 72..76 | CDD:409353 | 2/5 (40%) | ||
Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
FR3 | 84..118 | CDD:409353 | 10/33 (30%) | ||
Ig strand D | 87..94 | CDD:409353 | 2/6 (33%) | ||
Ig strand E | 97..103 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 119..123 | CDD:409353 | 2/3 (67%) | ||
Ig strand G | 123..132 | CDD:409353 | 3/9 (33%) | ||
FR4 | 125..132 | CDD:409353 | 2/7 (29%) | ||
Ig_3 | 136..205 | CDD:404760 | 27/81 (33%) | ||
Ig strand A' | 142..147 | CDD:409353 | 3/4 (75%) | ||
Ig strand B | 153..160 | CDD:409353 | 3/6 (50%) | ||
Ig strand C | 166..171 | CDD:409353 | 4/15 (27%) | ||
Ig strand D | 177..180 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 184..190 | CDD:409353 | 2/5 (40%) | ||
Ig strand F | 197..204 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 211..219 | CDD:409353 | 2/7 (29%) | ||
Ig_3 | 222..299 | CDD:404760 | 21/82 (26%) | ||
putative Ig strand A | 223..229 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 239..243 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 252..256 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 278..282 | CDD:409353 | 0/6 (0%) | ||
Ig strand F | 292..297 | CDD:409353 | 2/4 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 45 | 1.000 | Domainoid score | I12195 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 141 | 1.000 | Inparanoid score | I4481 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | mtm8497 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3058 |
SonicParanoid | 1 | 1.000 | - | - | X97 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
9 | 8.900 |