DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and NTM

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001338930.1 Gene:NTM / 50863 HGNCID:17941 Length:367 Species:Homo sapiens


Alignment Length:342 Identity:100/342 - (29%)
Similarity:156/342 - (45%) Gaps:39/342 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LEAIGAFQ--------PEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENV 90
            |.|:..||        ..|.:::.||:|..|..||..|.:.: ...||.||...|  |.....:.
Human    20 LAALCLFQGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDN-RVTRVAWLNRST--ILYAGNDK 81

  Fly    91 ITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTD--PMKSQIGFLDVVIPPDFISEDTSS 153
            ...:|||.:....|..:::.|:.|...|.|.|.|.:.||  |..|:: .|.|.:.|..:  :.||
Human    82 WCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRV-HLIVQVSPKIV--EISS 143

  Fly   154 DVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMG 218
            |:.:.||:::.|||.|.|.|||.||||           ::..|.:......|.|::..|:|.:.|
Human   144 DISINEGNNISLTCIATGRPEPTVTWR-----------HISPKAVGFVSEDEYLEIQGITREQSG 197

  Fly   219 SYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGE 283
            .|.|.|||.|...|.:|:.:::::.|.|..... .|.|:|....::|...|.|.:...|.||...
Human   198 DYECSASNDVAAPVVRRVKVTVNYPPYISEAKG-TGVPVGQKGTLQCEASAVPSAEFQWYKDDKR 261

  Fly   284 MIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRN-- 346
            :|  .||..|:..::....   .:|.....:.|.|:|.|:|.|.||..::||.|:|:..|..:  
Human   262 LI--EGKKGVKVENRPFLS---KLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFELNEPTSSTL 321

  Fly   347 ----KNPLNGGGKGGGA 359
                |.......||.||
Human   322 LQEVKTTALTPWKGPGA 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 23/79 (29%)
Ig 51..131 CDD:299845 24/81 (30%)
I-set 144..240 CDD:254352 32/95 (34%)
IGc2 159..228 CDD:197706 25/68 (37%)
Ig 244..337 CDD:299845 26/92 (28%)
I-set 244..337 CDD:254352 26/92 (28%)
NTMNP_001338930.1 Ig 44..132 CDD:416386 28/91 (31%)
Ig strand A' 44..49 CDD:409353 3/4 (75%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 0/4 (0%)
FR2 64..70 CDD:409353 3/5 (60%)
Ig strand C 64..70 CDD:409353 3/5 (60%)
CDR2 71..83 CDD:409353 2/13 (15%)
Ig strand C' 72..76 CDD:409353 2/5 (40%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 10/33 (30%)
Ig strand D 87..94 CDD:409353 2/6 (33%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 2/3 (67%)
Ig strand G 123..132 CDD:409353 3/9 (33%)
FR4 125..132 CDD:409353 2/7 (29%)
Ig_3 136..205 CDD:404760 27/81 (33%)
Ig strand A' 142..147 CDD:409353 3/4 (75%)
Ig strand B 153..160 CDD:409353 3/6 (50%)
Ig strand C 166..171 CDD:409353 4/15 (27%)
Ig strand D 177..180 CDD:409353 0/2 (0%)
Ig strand E 184..190 CDD:409353 2/5 (40%)
Ig strand F 197..204 CDD:409353 3/6 (50%)
Ig strand G 211..219 CDD:409353 2/7 (29%)
Ig_3 222..299 CDD:404760 21/82 (26%)
putative Ig strand A 223..229 CDD:409353 2/5 (40%)
Ig strand B 239..243 CDD:409353 0/3 (0%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 0/6 (0%)
Ig strand F 292..297 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12195
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3058
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.