DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr12

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:213 Identity:60/213 - (28%)
Similarity:90/213 - (42%) Gaps:32/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PEFVES---ISNVSVAVGRDATFTCHVRHLGGYRVG-------WLKADTKAIQAIHENVITHNPR 96
            |.|.:|   ..|.:|.:|..|...|.|.  |..|||       |::.....|.:....:.|::.|
  Fly    75 PMFEDSELMAHNTTVQLGGTAFLVCKVS--GVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDER 137

  Fly    97 VTVSHL-DQNTWNLHIKAVSEEDRGGYMCQLNTDP-MKSQIGFLDVVIPPDFISEDTSSDVIVPE 159
            ..:.|. ..|.|.|.||.|...|.|.|.||::|.. :.|....|.||:|..||.  .|.::.|..
  Fly   138 FAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFIL--GSGELHVDM 200

  Fly   160 GSSVRLTCRARGYPEP--IVTWRRED--------GNEIVLKDNVGTKTLAPSFRGEVLKLSKISR 214
            ||::.|.|.....|.|  .|.|::.|        ..:|.::...|.:|.:.      |.:.:...
  Fly   201 GSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSR------LIIREPQV 259

  Fly   215 NEMGSYLCIASNGVPPSV 232
            .:.|:|.|.|||..|.|:
  Fly   260 TDSGNYTCSASNTEPASI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 26/87 (30%)
Ig 51..131 CDD:299845 26/88 (30%)
I-set 144..240 CDD:254352 25/99 (25%)
IGc2 159..228 CDD:197706 19/78 (24%)
Ig 244..337 CDD:299845
I-set 244..337 CDD:254352
dpr12NP_652462.3 IG 86..183 CDD:214652 29/98 (30%)
Ig_3 193..271 CDD:404760 19/83 (23%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 1/9 (11%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.