DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and robo2

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster


Alignment Length:569 Identity:121/569 - (21%)
Similarity:194/569 - (34%) Gaps:155/569 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KRLLRN--------FQFTSCDRNGKMLIHLLLIVSLLEA---IGAFQ---PEFVESISNVSVAVG 56
            ||..||        .:....||:.:.:..|||:::.|..   :||.:   |..:|...:.:|...
  Fly    41 KRRHRNNRDFHGERLKIMPVDRSRRAVFPLLLLLAGLNGLTQVGALKGENPRIIEHPMDTTVPKN 105

  Fly    57 RDATFTCHVRHLGGYRVGW------LKADTKA------------IQAIHEN-------------- 89
            ...||.|.........:.|      ||.||.:            ::.||..              
  Fly   106 DPFTFNCQAEGNPTPTIQWFKDGRELKTDTGSHRIMLPAGGLFFLKVIHSRRESDAGTYWCEAKN 170

  Fly    90 ----VITHNPRVTVSHL-------------------------------DQNTW------------ 107
                ..:.|..:.|:.|                               .|.:|            
  Fly   171 EFGVARSRNATLQVAFLRDEFRLEPANTRVAQGEVALMECGAPRGSPEPQISWRKNGQTLNLVGN 235

  Fly   108 ---------NLHIKAVSEEDRGGYMCQLN--TDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGS 161
                     ||.|:...:.|.|.|.|.:.  ....:|...||.|.:.|..|....:...:|  ||
  Fly   236 KRIRIVDGGNLAIQEARQSDDGRYQCVVKNVVGTRESATAFLKVHVRPFLIRGPQNQTAVV--GS 298

  Fly   162 SVRLTCRARGYPEPIVTWRR--EDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIA 224
            ||...||..|.|.|.|.|||  ..||..:.:.:|        .....|||..::..:||.|.|.|
  Fly   299 SVVFQCRIGGDPLPDVLWRRTASGGNMPLRRVHV--------LEDRSLKLDDVTLEDMGEYTCEA 355

  Fly   225 SNGVPPSVSKRISLSIHFHP--VIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVT 287
            .|.|....:..| |::|..|  ||:..||||  .:|.:|..||.....|:...||..:....::.
  Fly   356 DNAVGGITATGI-LTVHAPPKFVIRPKNQLV--EIGDEVLFECQANGHPRPTLYWSVEGNSSLLL 417

  Fly   288 SGKYHVQESSQSMYETKMSMIVRKFQKDDVGS-YRCIAKNSLGEVDSSIRL-----YEIPGPNRN 346
            .|....:.......|.:..:.:.:|.::|.|. ..|.|.|::|.|.|...:     :|:|.|...
  Fly   418 PGYRDGRMEVTLTPEGRSVLSIARFAREDSGKVVTCNALNAVGSVSSRTVVSVDTQFELPPPIIE 482

  Fly   347 KNPLNG---------------GGKGGGAGGSLDADANDILKQKQQ---------VKVTYQPEDEE 387
            :.|:|.               |.........||....|:.:.:::         :....:.|||.
  Fly   483 QGPVNQTLPVKSIVVLPCRTLGTPVPQVSWYLDGIPIDVQEHERRNLSDAGALTISDLQRHEDEG 547

  Fly   388 LQYGSVEDFEAEGGEGGGL---TPLSPHVYYTSGNKPATHKPGNSGGNQ 433
            |......:...:....|.|   ||.:|::.:....:.:|: ||..|..|
  Fly   548 LYTCVASNRNGKSSWSGYLRLDTPTNPNIKFFRAPELSTY-PGPPGKPQ 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 23/169 (14%)
Ig strand B 59..63 CDD:409353 2/3 (67%)
Ig strand C 72..76 CDD:409353 1/9 (11%)
Ig strand E 103..111 CDD:409353 4/28 (14%)
Ig 152..240 CDD:472250 29/89 (33%)
Ig strand B 163..167 CDD:409275 1/3 (33%)
Ig strand C 176..180 CDD:409275 1/3 (33%)
Ig strand E 205..209 CDD:409275 1/3 (33%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 25/95 (26%)
Ig strand B 261..265 CDD:409353 1/3 (33%)
Ig strand C 274..278 CDD:409353 1/3 (33%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 319..324 CDD:409353 1/5 (20%)
Ig strand G 332..335 CDD:409353 1/2 (50%)
robo2NP_001259868.1 IgC_1_Robo 91..185 CDD:409490 14/93 (15%)
Ig strand A 91..95 CDD:409490 1/3 (33%)
Ig strand A' 98..103 CDD:409490 0/4 (0%)
Ig strand B 107..115 CDD:409490 3/7 (43%)
Ig strand C 121..126 CDD:409490 1/4 (25%)
Ig strand C' 129..131 CDD:409490 0/1 (0%)
Ig strand D 139..142 CDD:409490 0/2 (0%)
Ig strand E 145..151 CDD:409490 0/5 (0%)
Ig strand F 162..170 CDD:409490 0/7 (0%)
Ig strand G 173..185 CDD:409490 1/11 (9%)
IgI_2_Robo 192..279 CDD:409389 12/86 (14%)
Ig strand A 192..195 CDD:409389 0/2 (0%)
Ig strand A' 197..201 CDD:409389 0/3 (0%)
Ig strand B 205..212 CDD:409389 0/6 (0%)
Ig strand C 220..225 CDD:409389 2/4 (50%)
Ig strand C' 227..230 CDD:409389 0/2 (0%)
Ig strand D 237..241 CDD:409389 0/3 (0%)
Ig strand E 244..250 CDD:409389 3/5 (60%)
Ig strand F 257..265 CDD:409389 3/7 (43%)
Ig strand G 268..279 CDD:409389 3/10 (30%)
Ig 286..370 CDD:472250 30/94 (32%)
Ig strand B 300..304 CDD:409353 1/3 (33%)
Ig strand C 313..317 CDD:409353 1/3 (33%)
Ig strand E 336..340 CDD:409353 1/3 (33%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
Ig_3 373..457 CDD:464046 21/85 (25%)
Ig 480..566 CDD:472250 11/85 (13%)
Ig strand B 496..500 CDD:409353 0/3 (0%)
Ig strand C 509..513 CDD:409353 0/3 (0%)
Ig strand E 533..537 CDD:409353 0/3 (0%)
Ig strand F 548..553 CDD:409353 1/4 (25%)
Ig strand G 561..564 CDD:409353 0/2 (0%)
COG3979 586..>800 CDD:443178 5/11 (45%)
FN3 588..681 CDD:238020 4/8 (50%)
fn3 864..952 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.