DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr15

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_731672.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster


Alignment Length:371 Identity:78/371 - (21%)
Similarity:116/371 - (31%) Gaps:97/371 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRV-TVSHLDQN 105
            |..::....:....|..|...|:|:.|....:.||:.....|..:.:.....:.|. :|...:..
  Fly   190 PPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPE 254

  Fly   106 TWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIP-PDFISEDTSSDVIVPEGSSVRLTCRA 169
            .|:|.||.|..:|.|.|.||::|:|..|.|..|.:|.| .:.|.|.|..   |..||.|:|.|..
  Fly   255 RWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPKTELIGESTRH---VKAGSQVKLRCII 316

  Fly   170 RGYPEP--IVTW-----------RREDGNEIVLKD------------------------NVGTKT 197
            ....||  .:.|           ||....||...|                        ...|..
  Fly   317 SQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTTP 381

  Fly   198 LAPS----------FRGEVLK----------LSKISRN---EMGSYLCIA--------------- 224
            ..||          ...|.|.          |..||:|   |:|:...:|               
  Fly   382 ATPSTTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAVATETSTAQLLTEVE 446

  Fly   225 ----SNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWI----KDT 281
                ::|.........|.|..:         ..||..|..........|:..:.:.|:    .:.
  Fly   447 ATSSTSGTSTGAGLLASTSAAY---------AAGAAAGITTAATGDSAATAATTSAWLTTMDAEA 502

  Fly   282 GEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNS 327
            .....|:....:..||.....|..|:|:....|.|.|:|.|...||
  Fly   503 ATTAATTTTTMLPSSSFIKQITTASLIIPAVVKLDSGNYTCSPSNS 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 20/80 (25%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 0/3 (0%)
Ig strand E 103..111 CDD:409353 2/7 (29%)
Ig 152..240 CDD:472250 28/166 (17%)
Ig strand B 163..167 CDD:409275 2/3 (67%)
Ig strand C 176..180 CDD:409275 1/14 (7%)
Ig strand E 205..209 CDD:409275 2/13 (15%)
Ig strand F 219..224 CDD:409275 0/4 (0%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 18/88 (20%)
Ig strand B 261..265 CDD:409353 0/3 (0%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 1/3 (33%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353
dpr15NP_731672.1 V-set 204..290 CDD:462230 25/85 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.