DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr17

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:204 Identity:55/204 - (26%)
Similarity:86/204 - (42%) Gaps:18/204 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQN--TWNLH 110
            :.|::..:|..|...|.:..|....|.|::.....|.::.|.....:.|....:.:.:  ||:|.
  Fly   412 VLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQ 476

  Fly   111 IKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEP 175
            ||.|...|.|.|.||:.|:|..|....|.:|.|...:..|.|.  .|..||.|.|.|..||..:|
  Fly   477 IKYVEPSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQSR--FVKAGSKVALHCIVRGTLDP 539

  Fly   176 --IVTWRR-----EDGNE-----IVLKDNV-GTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNG 227
              .:.|.|     .|.:|     ..|..|: ||.....:..|.:: :..:.:.:.|:|.|..||.
  Fly   540 PKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLI-IPLVRKEDSGNYTCQPSNS 603

  Fly   228 VPPSVSKRI 236
            |..||...:
  Fly   604 VSVSVDLHV 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 21/81 (26%)
Ig 51..131 CDD:299845 21/81 (26%)
I-set 144..240 CDD:254352 28/106 (26%)
IGc2 159..228 CDD:197706 22/81 (27%)
Ig 244..337 CDD:299845
I-set 244..337 CDD:254352
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 19/76 (25%)
Ig 415..507 CDD:299845 24/91 (26%)
IG_like 521..612 CDD:214653 26/91 (29%)
IGc2 524..605 CDD:197706 22/81 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12107
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.