Sequence 1: | NP_001259218.1 | Gene: | DIP-alpha / 31322 | FlyBaseID: | FBgn0052791 | Length: | 554 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287297.1 | Gene: | dpr17 / 41470 | FlyBaseID: | FBgn0051361 | Length: | 664 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 55/204 - (26%) |
---|---|---|---|
Similarity: | 86/204 - (42%) | Gaps: | 18/204 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 ISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQN--TWNLH 110
Fly 111 IKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEP 175
Fly 176 --IVTWRR-----EDGNE-----IVLKDNV-GTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNG 227
Fly 228 VPPSVSKRI 236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-alpha | NP_001259218.1 | IG_like | 49..129 | CDD:214653 | 21/81 (26%) |
Ig | 51..131 | CDD:299845 | 21/81 (26%) | ||
I-set | 144..240 | CDD:254352 | 28/106 (26%) | ||
IGc2 | 159..228 | CDD:197706 | 22/81 (27%) | ||
Ig | 244..337 | CDD:299845 | |||
I-set | 244..337 | CDD:254352 | |||
dpr17 | NP_001287297.1 | IG_like | 414..491 | CDD:214653 | 19/76 (25%) |
Ig | 415..507 | CDD:299845 | 24/91 (26%) | ||
IG_like | 521..612 | CDD:214653 | 26/91 (29%) | ||
IGc2 | 524..605 | CDD:197706 | 22/81 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 45 | 1.000 | Domainoid score | I12107 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |