DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr5

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:268 Identity:70/268 - (26%)
Similarity:110/268 - (41%) Gaps:51/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RNGKMLIHLLLIVSLLEAI----GAFQPEFVESIS-NVSVAVGRDATFTCHVRHLGGYRVGWLKA 78
            |:.:...||.....|...|    .|..|.|..:.. .|..|:|..|...|.|||||...|.|::.
  Fly    63 RSSQYFGHLAAAEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQ 127

  Fly    79 DTKAIQAIHENVITHNPRVTVSHLD-QNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVI 142
            ....|..|.....|::.|....|:| .:.|.|.|.:|.:.|.|.|.||::|:| |..:.:..||:
  Fly   128 RDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEP-KISLAYKLVVV 191

  Fly   143 PPDFISEDTSS-------DVIVPEGSSVRLTCRARGYPEPI--VTWRREDGNEIVLKDNVGTKTL 198
                    ||.       ::.:..||.:.|||.|...|.|.  :.|.::            |:.:
  Fly   192 --------TSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKD------------TELV 236

  Fly   199 APSFRGEV------------LKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQ--VP 249
            :.|.||.:            |.:|::...:.|:|.|.|.|....||...| :....|..:|  :.
  Fly   237 SDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNSDSVFVHI-IKSEQHAAMQHELG 300

  Fly   250 NQLVGAPL 257
            ::|:..||
  Fly   301 SRLLLPPL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 27/81 (33%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 3/8 (38%)
Ig 152..240 CDD:472250 24/108 (22%)
Ig strand B 163..167 CDD:409275 1/3 (33%)
Ig strand C 176..180 CDD:409275 0/5 (0%)
Ig strand E 205..209 CDD:409275 1/15 (7%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 4/16 (25%)
Ig strand B 261..265 CDD:409353
Ig strand C 274..278 CDD:409353
Ig strand E 305..309 CDD:409353
Ig strand F 319..324 CDD:409353
Ig strand G 332..335 CDD:409353
dpr5NP_650080.3 FR1 96..113 CDD:409355 4/16 (25%)
IG_like 98..179 CDD:214653 27/80 (34%)
Ig strand A' 100..102 CDD:409355 1/1 (100%)
Ig strand B 106..114 CDD:409355 2/7 (29%)
CDR1 114..120 CDD:409355 5/5 (100%)
FR2 121..132 CDD:409355 2/10 (20%)
Ig strand C 121..127 CDD:409355 2/5 (40%)
Ig strand C' 130..133 CDD:409355 0/2 (0%)
CDR2 133..146 CDD:409355 2/12 (17%)
Ig strand D 146..151 CDD:409355 0/4 (0%)
FR3 147..176 CDD:409355 10/28 (36%)
Ig strand E 155..162 CDD:409355 2/6 (33%)
Ig strand F 170..177 CDD:409355 4/6 (67%)
IG_like 206..278 CDD:214653 20/83 (24%)
Ig strand B 211..215 CDD:409353 1/3 (33%)
Ig strand C 226..230 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 1/3 (33%)
Ig strand F 269..274 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.