DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and Ama

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:340 Identity:92/340 - (27%)
Similarity:155/340 - (45%) Gaps:30/340 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KMLIHLL--LIVSLLEAIGAFQPEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLK----ADT 80
            ::||.|:  |.:||...:.|  |...:...:|..:||....|.|.|..:|...|.|.|    :||
  Fly    13 RLLIGLIFCLAISLDSVLSA--PVISQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDT 75

  Fly    81 KAIQAIHENVIT-----HNPRVTVS-HLDQNTWNLHIKAVSEEDRGGYMCQL---NTDPMKSQIG 136
            .::.....|:::     :|..||.. ......:...|:.:...|.|.|.||:   .|:.:..::.
  Fly    76 NSVVLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLS 140

  Fly   137 FLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPS 201
             |.:..|| .|:|:|....:|.||.::.|||.|.|:|:|.::|.||. |.::   ..|...||. 
  Fly   141 -LQIKTPP-VIAENTPKSTLVTEGQNLELTCHANGFPKPTISWAREH-NAVM---PAGGHLLAE- 198

  Fly   202 FRGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECH 266
               ..|::..:.|.:.|.|.|||.||......:.|.:.:.|.|.|.|....:...:....::||.
  Fly   199 ---PTLRIRSVHRMDRGGYYCIAQNGEGQPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECS 260

  Fly   267 VEASPKSINYWIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEV 331
            |:..|.....|.|: |..:.:|..:.|..::.|...|...:.:....::|.|.|.|.|.|.||..
  Fly   261 VQGYPAPTVVWHKN-GVPLQSSRHHEVANTASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHA 324

  Fly   332 DSSIRLYE--IPGPN 344
            |:.:.|::  ||.|:
  Fly   325 DARLHLFQTVIPVPS 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 22/92 (24%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 0/7 (0%)
Ig 152..240 CDD:472250 27/87 (31%)
Ig strand B 163..167 CDD:409275 1/3 (33%)
Ig strand C 176..180 CDD:409275 0/3 (0%)
Ig strand E 205..209 CDD:409275 1/3 (33%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 23/92 (25%)
Ig strand B 261..265 CDD:409353 0/3 (0%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353 1/2 (50%)
AmaNP_731114.2 I-set 33..143 CDD:400151 25/110 (23%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 63..68 CDD:409353 2/4 (50%)
Ig strand E 101..112 CDD:409353 0/10 (0%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig_3 146..220 CDD:464046 29/82 (35%)
I-set 254..330 CDD:400151 20/76 (26%)
Ig strand B 255..259 CDD:409353 0/3 (0%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 298..302 CDD:409353 0/3 (0%)
Ig strand F 312..317 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.