DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr11

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:229 Identity:66/229 - (28%)
Similarity:95/229 - (41%) Gaps:24/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LLLIVSLLEAIGAFQPEFVE--SISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHEN 89
            ||...|.|.|.......:::  :.|||:..:|..|...|.|:.||...|.|::.....|..:...
  Fly   101 LLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRA 165

  Fly    90 VITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIP-PDFISEDTSS 153
            |...:.|..........|.|.||.|...|.|.|.||::|:|..|....|.||:| .:.:.|   .
  Fly   166 VFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGE---P 227

  Fly   154 DVIVPEGSSVRLTCRARGYPEP--IVTWRREDGNEIVLKDNVGTKTL----APSFRGE------V 206
            |..|..||:|.|.|..||..||  .:.|..  |.|.:..|:...:|.    .|...||      .
  Fly   228 DRYVKAGSNVVLRCIVRGALEPPTFIMWYH--GAEQLAADSRRHRTQLDPNLPEASGEGQSTIGS 290

  Fly   207 LKLSKISRNEMGSYLCIASNGVPPSVSKRISLSI 240
            |.:....:.:.|:|.|..||    |.|..::|:|
  Fly   291 LIIESAKKRDTGNYTCSPSN----SPSATVTLNI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 24/79 (30%)
Ig 51..131 CDD:299845 23/79 (29%)
I-set 144..240 CDD:254352 29/107 (27%)
IGc2 159..228 CDD:197706 23/80 (29%)
Ig 244..337 CDD:299845
I-set 244..337 CDD:254352
dpr11NP_001262320.1 I-set 125..216 CDD:254352 28/90 (31%)
Ig 127..217 CDD:299845 26/89 (29%)
IG_like 227..320 CDD:214653 28/98 (29%)
IGc2 234..311 CDD:197706 23/82 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.