DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr10

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:383 Identity:85/383 - (22%)
Similarity:126/383 - (32%) Gaps:149/383 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 NVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVS-HLDQNTWNLHIKA 113
            |::..||:.|...|.|:|||...|.|::.....|..:.....|.:.|...| |.|.:.|.|.||.
  Fly    62 NITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKW 126

  Fly   114 VSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSS------------------------- 153
            ..:.|.|.|.||::|.|::|....|::|   |.|..:||.                         
  Fly   127 AQQRDAGVYECQ
ISTQPVRSYSVNLNIV---DLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDE 188

  Fly   154 ----------------------DVIVPEGSSVRLTCRARGYPEP--IVTWRREDGNEIVLKDNVG 194
                                  |:.|.:||::.|||..:..|||  .:.|..:|           
  Fly   189 FAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQD----------- 242

  Fly   195 TKTLAPSFRGEVLKLSKISRNE--------------MGSYLCIASNGVPPSVSKRISLSIHFHPV 245
             |.|:....|..||...|...|              .|.|.|..||      ::..|:.:|   |
  Fly   243 -KVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSN------TEIASIRVH---V 297

  Fly   246 IQVPN----QLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQS--MYETK 304
            :|...    |...||..  |.:.|           |            ..|..:::|:  :..|.
  Fly   298 LQGERPEAMQTNAAPAA--VALAC-----------W------------SCHFGQATQAVRVISTM 337

  Fly   305 MSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRNKNPLNGGGKGGGAGGS 362
            ::.:|                  |.|..||:.|.            :|||.|...|||
  Fly   338 VAALV------------------LLEACSSLLLQ------------SGGGGGCPGGGS 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 26/79 (33%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 3/7 (43%)
Ig 152..240 CDD:472250 26/150 (17%)
Ig strand B 163..167 CDD:409275 1/3 (33%)
Ig strand C 176..180 CDD:409275 0/3 (0%)
Ig strand E 205..209 CDD:409275 1/3 (33%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 16/98 (16%)
Ig strand B 261..265 CDD:409353 1/3 (33%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 319..324 CDD:409353 0/4 (0%)
Ig strand G 332..335 CDD:409353 1/2 (50%)
dpr10NP_729591.1 Ig 53..138 CDD:472250 24/75 (32%)
Ig strand B 71..75 CDD:409371 1/3 (33%)
Ig strand E 120..124 CDD:409371 2/3 (67%)
Ig_3 214..287 CDD:464046 21/84 (25%)

Return to query results.
Submit another query.