DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr10

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:383 Identity:85/383 - (22%)
Similarity:126/383 - (32%) Gaps:149/383 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 NVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVS-HLDQNTWNLHIKA 113
            |::..||:.|...|.|:|||...|.|::.....|..:.....|.:.|...| |.|.:.|.|.||.
  Fly    62 NITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKW 126

  Fly   114 VSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSS------------------------- 153
            ..:.|.|.|.||::|.|::|....|::|   |.|..:||.                         
  Fly   127 AQQRDAGVYECQISTQPVRSYSVNLNIV---DLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDE 188

  Fly   154 ----------------------DVIVPEGSSVRLTCRARGYPEP--IVTWRREDGNEIVLKDNVG 194
                                  |:.|.:||::.|||..:..|||  .:.|..:|           
  Fly   189 FAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQD----------- 242

  Fly   195 TKTLAPSFRGEVLKLSKISRNE--------------MGSYLCIASNGVPPSVSKRISLSIHFHPV 245
             |.|:....|..||...|...|              .|.|.|..||      ::..|:.:|   |
  Fly   243 -KVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSN------TEIASIRVH---V 297

  Fly   246 IQVPN----QLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQS--MYETK 304
            :|...    |...||..  |.:.|           |            ..|..:::|:  :..|.
  Fly   298 LQGERPEAMQTNAAPAA--VALAC-----------W------------SCHFGQATQAVRVISTM 337

  Fly   305 MSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRNKNPLNGGGKGGGAGGS 362
            ::.:|                  |.|..||:.|.            :|||.|...|||
  Fly   338 VAALV------------------LLEACSSLLLQ------------SGGGGGCPGGGS 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 26/79 (33%)
Ig 51..131 CDD:299845 26/80 (33%)
I-set 144..240 CDD:254352 29/158 (18%)
IGc2 159..228 CDD:197706 22/84 (26%)
Ig 244..337 CDD:299845 16/98 (16%)
I-set 244..337 CDD:254352 16/98 (16%)
dpr10NP_729591.1 Ig 63..143 CDD:299845 26/79 (33%)
IG_like 210..297 CDD:214653 26/107 (24%)
IGc2 217..287 CDD:197706 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.