DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr13

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:271 Identity:70/271 - (25%)
Similarity:110/271 - (40%) Gaps:50/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQN-TWNL 109
            |:.:.|:..:|..|...|.|.|:|...|.|::.....:..:.....:.:.|.:.:||..: .|.|
  Fly   180 ENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTL 244

  Fly   110 HIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSDV--IVPEGSSVRLTCRARGY 172
            .||.|...|.|.|.||::|.|..|....|.||   :..:|.|...:  :.| ||::||.||....
  Fly   245 QIKFVQLRDAGVYECQVSTHPPTSIFLHLSVV---EARAEITGPPIRYLTP-GSTLRLQCRVVQN 305

  Fly   173 PE--PIVTWRREDGNEIVLKD-----NVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPP 230
            .|  ..:.|..:  |.::..|     ||.|:   |.|:...|.:.:..|...|::.|:|||..|.
  Fly   306 TEASEYIFWYHD--NRMINYDIDRGINVSTE---PDFQSSELTIQRTRREHSGNFTCVASNTQPA 365

  Fly   231 SVSKRI------SLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSG 289
            ||...|      :...|.|         ||....| .|.:.|:               .||:.:.
  Fly   366 SVLVHIFKGDNPAAMYHGH---------VGGSTKT-TQSQLHM---------------IMIIIAS 405

  Fly   290 KYHVQESSQSM 300
            .|.:..:|..|
  Fly   406 GYRIFHTSVYM 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 22/80 (28%)
Ig 51..131 CDD:299845 23/80 (29%)
I-set 144..240 CDD:254352 29/110 (26%)
IGc2 159..228 CDD:197706 22/75 (29%)
Ig 244..337 CDD:299845 10/57 (18%)
I-set 244..337 CDD:254352 10/57 (18%)
dpr13NP_001033956.2 V-set 180..276 CDD:284989 27/95 (28%)
IG_like 182..262 CDD:214653 22/79 (28%)
IG_like 285..362 CDD:214653 22/82 (27%)
IGc2 292..361 CDD:197706 21/74 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.